Red Supps Products The ultimate product feed for Facebook - part of the Pixel Perfect app by wyred-up https://redsupps.co.uk shopify_369642438693_4714185785381"make bodybuilding great again" Emblazoned with a red, white, and blue variant of the blackstone labs logo. "make bodybuilding great again" is printed on the back.https://redsupps.co.uk/products/blackstone-labs-make-bodybuilding-great-againhttps://cdn.shopify.com/s/files/1/2544/1734/products/makebodybuildinggreatagain-01-600x857_1024x_2290dd12-cb16-4f69-b290-b5bea5d60c59_600x600_crop_center.jpg?v=1543507097Blackstone Labs new 369642438693in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_369642438693_4714185818149"make bodybuilding great again" Emblazoned with a red, white, and blue variant of the blackstone labs logo. "make bodybuilding great again" is printed on the back.https://redsupps.co.uk/products/blackstone-labs-make-bodybuilding-great-againhttps://cdn.shopify.com/s/files/1/2544/1734/products/makebodybuildinggreatagain-01-600x857_1024x_2290dd12-cb16-4f69-b290-b5bea5d60c59_600x600_crop_center.jpg?v=1543507097Blackstone Labs new 369642438693in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_8084826259507"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1543507100Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_8084826292275"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1543507100Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_8084826325043"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1543507100Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_8084826357811"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1543507100Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_8084826390579"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1543507100Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_13021730373683"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1543507100Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_13021730406451"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1543507100Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_13021730439219"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1543507100Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_13021730471987"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1543507100Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_13021730504755"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1543507100Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_699340587059_8438659711027"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1543507103Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_699340587059_8438659743795"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1543507103Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_699340587059_8438659776563"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1543507103Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_699340587059_8438659809331"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1543507103Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_699340587059_8438659842099"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1543507103Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_699340587059_15607460298803"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1543507103Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_699340587059_15607460331571"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1543507103Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_699340587059_15607460364339"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1543507103Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_699340587059_15607460429875"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1543507103Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_699340587059_15607460495411"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1543507103Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_474919960613_5242680344613''loyality is everything'' 100% preshrunk cotton with a classic fit.whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym. let them know that staying true is everything with this #beauthentic tee today.https://redsupps.co.uk/products/loyality-is-everythinghttps://cdn.shopify.com/s/files/1/2544/1734/products/loyalty-is-everything_1024x_151b1402-e290-4889-bdfd-4face192faf3_600x600_crop_center.jpg?v=1543507108Blackstone Labs new 474919960613in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_474919960613_5242680377381''loyality is everything'' 100% preshrunk cotton with a classic fit.whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym. let them know that staying true is everything with this #beauthentic tee today.https://redsupps.co.uk/products/loyality-is-everythinghttps://cdn.shopify.com/s/files/1/2544/1734/products/loyalty-is-everything_1024x_151b1402-e290-4889-bdfd-4face192faf3_600x600_crop_center.jpg?v=1543507108Blackstone Labs new 474919960613in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_474919960613_5242680410149''loyality is everything'' 100% preshrunk cotton with a classic fit.whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym. let them know that staying true is everything with this #beauthentic tee today.https://redsupps.co.uk/products/loyality-is-everythinghttps://cdn.shopify.com/s/files/1/2544/1734/products/loyalty-is-everything_1024x_151b1402-e290-4889-bdfd-4face192faf3_600x600_crop_center.jpg?v=1543507108Blackstone Labs new 474919960613in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_474919960613_5242680442917''loyality is everything'' 100% preshrunk cotton with a classic fit.whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym. let them know that staying true is everything with this #beauthentic tee today.https://redsupps.co.uk/products/loyality-is-everythinghttps://cdn.shopify.com/s/files/1/2544/1734/products/loyalty-is-everything_1024x_151b1402-e290-4889-bdfd-4face192faf3_600x600_crop_center.jpg?v=1543507108Blackstone Labs new 474919960613in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_474919960613_5242680475685''loyality is everything'' 100% preshrunk cotton with a classic fit.whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym. let them know that staying true is everything with this #beauthentic tee today.https://redsupps.co.uk/products/loyality-is-everythinghttps://cdn.shopify.com/s/files/1/2544/1734/products/loyalty-is-everything_1024x_151b1402-e290-4889-bdfd-4face192faf3_600x600_crop_center.jpg?v=1543507108Blackstone Labs new 474919960613in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_474919960613_15826574573619''loyality is everything'' 100% preshrunk cotton with a classic fit.whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym. let them know that staying true is everything with this #beauthentic tee today.https://redsupps.co.uk/products/loyality-is-everythinghttps://cdn.shopify.com/s/files/1/2544/1734/products/loyalty-is-everything_1024x_151b1402-e290-4889-bdfd-4face192faf3_600x600_crop_center.jpg?v=1543507108Blackstone Labs new 474919960613in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_474919960613_15826574606387''loyality is everything'' 100% preshrunk cotton with a classic fit.whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym. let them know that staying true is everything with this #beauthentic tee today.https://redsupps.co.uk/products/loyality-is-everythinghttps://cdn.shopify.com/s/files/1/2544/1734/products/loyalty-is-everything_1024x_151b1402-e290-4889-bdfd-4face192faf3_600x600_crop_center.jpg?v=1543507108Blackstone Labs new 474919960613in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_474919960613_15826574639155''loyality is everything'' 100% preshrunk cotton with a classic fit.whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym. let them know that staying true is everything with this #beauthentic tee today.https://redsupps.co.uk/products/loyality-is-everythinghttps://cdn.shopify.com/s/files/1/2544/1734/products/loyalty-is-everything_1024x_151b1402-e290-4889-bdfd-4face192faf3_600x600_crop_center.jpg?v=1543507108Blackstone Labs new 474919960613in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_474919960613_15826574671923''loyality is everything'' 100% preshrunk cotton with a classic fit.whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym. let them know that staying true is everything with this #beauthentic tee today.https://redsupps.co.uk/products/loyality-is-everythinghttps://cdn.shopify.com/s/files/1/2544/1734/products/loyalty-is-everything_1024x_151b1402-e290-4889-bdfd-4face192faf3_600x600_crop_center.jpg?v=1543507108Blackstone Labs new 474919960613in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_474919960613_15826574704691''loyality is everything'' 100% preshrunk cotton with a classic fit.whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym. let them know that staying true is everything with this #beauthentic tee today.https://redsupps.co.uk/products/loyality-is-everythinghttps://cdn.shopify.com/s/files/1/2544/1734/products/loyalty-is-everything_1024x_151b1402-e290-4889-bdfd-4face192faf3_600x600_crop_center.jpg?v=1543507108Blackstone Labs new 474919960613in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 0.00GBP shopify_1488867917875_13401168412723100% noway bodybalance hcp protein descriptionnoway is just that – no whey. for those that are ready to ditch the dairy, find they have a sensitive stomach and want the benefits of supplementing with collagen while filling in your protein requirements; then read about the research below on how collagen protein is beneficial for the body. bodybalance hydrolyzed bovine collagen is extracted at a particular temperature to keep the aminos and their peptide shuttle intact, they are semi digested from the process at which they are extracted making it extremely bio-efficient for processes in the body!noway bodybalance™whey protein has been the staple in gyms for decades for the growth of lean muscle tissue and for good reason. whey contains a high biologically active protein for muscle growth, is low in fat and carbohydrates and contains some natural growth factors. the great news is that scientific advancements have now taken protein supplements to the next level.  the decades of scientific research since whey hit the gyms has culminated in a vastly superior protein and collagen rich supplement that can boost your hard-earned muscle gain and fat loss results so as you can maximise your muscle gain and minimise your love handles.noway bodybalance™ has excellent bioavailability and bio-efficacynoway bodybalance™ is a unique combination of bioactive dietary peptides (very absorbable protein) from hydrolysed bovine collagen. what this means to you is that you will be taking the most biologically available protein, which has been already broken down in a vastly superior absorbable form to target your muscles for maximum growth. the bioactive peptides do not need to be digested further and are absorbed intact and delivered to your muscles where they work like a ‘lock and key’ to induce a specific function. the peptides then are broken down to release the amino acids at the target site. studies have found that you can achieve 3 x more muscle growth than whey, 2.5 x more fat loss than whey and 3.75 x more muscle power than whey.¹figure 1. the bioactive peptides are absorbed intact within minutes bypassing across the mucosal barrier as a complete peptide that is no longer subject to enzymatic cleavage.  this is rapidly followed by a high peak of systemic amino acids.noway bodybalance™ is made using a unique process recreating a digestive process with specific acids and enzymes capable of making a specific functioning blend. this means half the digestion work has been done for you! your body can then focus on getting the peptides and amino acids into the muscles where they belong for vastly better results than whey alone.feed collagenbut this is not simply a great form of protein. remember, whey is good but collagen protein is better. were you aware that collagen is the most abundant protein in the human body? 30-40% of all the protein in your body is made of collagen² noway bodybalance™ is a hydrolyzed collagen protein, meaning it feeds the 30-40% of your body protein whey barely touches, as well as the other 60-70%. this means better results, and given the hours you spend in the gym each week, you deserve them.did you know that less than 10% of your skeletal muscle mass is made up of collagen yet, 30% of your strength and power comes from this collagenous connective tissue? if it is power and performance that you are after, then you need to feed your collagen.figure 2. stimulation of connective tissue compared to whey.³every batch of noway bodybalance™ is tested to confirm the presence and activity of the specific protein peptides to ensure efficacy and consistency so you can rest easy knowing what is on the label is what you are really getting.collagen makes up 30-40% of the protein in the body.collagen is less than 10% of the muscle but generates 30% of strength and power.tendon: collagenous tissue that connects muscle and boneendomysium: collagenous tissue that wraps every single muscle fiberperimysium: collagenous connective tissue that bundles several muscle fibersepimysium: collagenous connective tissue that wraps the whole musclefascia: collagenous connective tissue that covers the entire muscle, located over the layer of epimysiumacid: base balance noway bodybalance™ alkalizing protein not alkaline proteinunique amino acid profile(these include high amounts of hydroxyproline, bioavailable arginine and glycine)hydroxyproline is unique to collagen.it is not found in whey or vegetable proteins. hydroxyproline is the major amino acids working with the bioactive peptides responsible for the enhanced collagen support seen with noway bodybalancehigh levels of bioavailable arginineas the collagen peptides are absorbed intact and the amino acids are liberated in the periphery; arginine can bypass the issues with oral absorption of l-arginine from the gut and deliver it directly to the peripheral tissue.arginine induces no vasodilation in the microvasculature of the musclearginine aids creatine synthesis and replenishmentarginine is involved in protein synthesishigh levels of glycineworks with arginine for creatine synthesisworks with the hydroxyproline for connective tissue synthesismost simple amino acid building block / precursor for several pathways involved in;antioxidant defence systemsglycogen replenishmentneurotransmitter functiondemonstrated in noway bodybalance™ scienceproper training can build muscleproper training with adequate macros (protein, fats and carbohydrates) improves your results from trainingmaking 15 grams of noway bodybalance™ part of your daily protein allocation can amplify your results significantly 3 x more muscle growth than whey 2.5 x more fat loss than whey 3.75 x more muscle power than whey4for optimal results, please consume noway bodybalance™ with a suitable nutrition and exercise program.these statements have not been evaluated by the food and drug administration. these products are not intended to diagnose, treat, cure, or prevent any diseasehttps://redsupps.co.uk/products/100-noway-bodybalance-hcp-proteinhttps://cdn.shopify.com/s/files/1/2544/1734/products/Noway-Choc-website_600x600_crop_center.jpg?v=1543507113ATP Science new 1488867917875in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsBodybalance HCP Protein 44.99GBP shopify_1488867917875_13401183060019100% noway bodybalance hcp protein descriptionnoway is just that – no whey. for those that are ready to ditch the dairy, find they have a sensitive stomach and want the benefits of supplementing with collagen while filling in your protein requirements; then read about the research below on how collagen protein is beneficial for the body. bodybalance hydrolyzed bovine collagen is extracted at a particular temperature to keep the aminos and their peptide shuttle intact, they are semi digested from the process at which they are extracted making it extremely bio-efficient for processes in the body!noway bodybalance™whey protein has been the staple in gyms for decades for the growth of lean muscle tissue and for good reason. whey contains a high biologically active protein for muscle growth, is low in fat and carbohydrates and contains some natural growth factors. the great news is that scientific advancements have now taken protein supplements to the next level.  the decades of scientific research since whey hit the gyms has culminated in a vastly superior protein and collagen rich supplement that can boost your hard-earned muscle gain and fat loss results so as you can maximise your muscle gain and minimise your love handles.noway bodybalance™ has excellent bioavailability and bio-efficacynoway bodybalance™ is a unique combination of bioactive dietary peptides (very absorbable protein) from hydrolysed bovine collagen. what this means to you is that you will be taking the most biologically available protein, which has been already broken down in a vastly superior absorbable form to target your muscles for maximum growth. the bioactive peptides do not need to be digested further and are absorbed intact and delivered to your muscles where they work like a ‘lock and key’ to induce a specific function. the peptides then are broken down to release the amino acids at the target site. studies have found that you can achieve 3 x more muscle growth than whey, 2.5 x more fat loss than whey and 3.75 x more muscle power than whey.¹figure 1. the bioactive peptides are absorbed intact within minutes bypassing across the mucosal barrier as a complete peptide that is no longer subject to enzymatic cleavage.  this is rapidly followed by a high peak of systemic amino acids.noway bodybalance™ is made using a unique process recreating a digestive process with specific acids and enzymes capable of making a specific functioning blend. this means half the digestion work has been done for you! your body can then focus on getting the peptides and amino acids into the muscles where they belong for vastly better results than whey alone.feed collagenbut this is not simply a great form of protein. remember, whey is good but collagen protein is better. were you aware that collagen is the most abundant protein in the human body? 30-40% of all the protein in your body is made of collagen² noway bodybalance™ is a hydrolyzed collagen protein, meaning it feeds the 30-40% of your body protein whey barely touches, as well as the other 60-70%. this means better results, and given the hours you spend in the gym each week, you deserve them.did you know that less than 10% of your skeletal muscle mass is made up of collagen yet, 30% of your strength and power comes from this collagenous connective tissue? if it is power and performance that you are after, then you need to feed your collagen.figure 2. stimulation of connective tissue compared to whey.³every batch of noway bodybalance™ is tested to confirm the presence and activity of the specific protein peptides to ensure efficacy and consistency so you can rest easy knowing what is on the label is what you are really getting.collagen makes up 30-40% of the protein in the body.collagen is less than 10% of the muscle but generates 30% of strength and power.tendon: collagenous tissue that connects muscle and boneendomysium: collagenous tissue that wraps every single muscle fiberperimysium: collagenous connective tissue that bundles several muscle fibersepimysium: collagenous connective tissue that wraps the whole musclefascia: collagenous connective tissue that covers the entire muscle, located over the layer of epimysiumacid: base balance noway bodybalance™ alkalizing protein not alkaline proteinunique amino acid profile(these include high amounts of hydroxyproline, bioavailable arginine and glycine)hydroxyproline is unique to collagen.it is not found in whey or vegetable proteins. hydroxyproline is the major amino acids working with the bioactive peptides responsible for the enhanced collagen support seen with noway bodybalancehigh levels of bioavailable arginineas the collagen peptides are absorbed intact and the amino acids are liberated in the periphery; arginine can bypass the issues with oral absorption of l-arginine from the gut and deliver it directly to the peripheral tissue.arginine induces no vasodilation in the microvasculature of the musclearginine aids creatine synthesis and replenishmentarginine is involved in protein synthesishigh levels of glycineworks with arginine for creatine synthesisworks with the hydroxyproline for connective tissue synthesismost simple amino acid building block / precursor for several pathways involved in;antioxidant defence systemsglycogen replenishmentneurotransmitter functiondemonstrated in noway bodybalance™ scienceproper training can build muscleproper training with adequate macros (protein, fats and carbohydrates) improves your results from trainingmaking 15 grams of noway bodybalance™ part of your daily protein allocation can amplify your results significantly 3 x more muscle growth than whey 2.5 x more fat loss than whey 3.75 x more muscle power than whey4for optimal results, please consume noway bodybalance™ with a suitable nutrition and exercise program.these statements have not been evaluated by the food and drug administration. these products are not intended to diagnose, treat, cure, or prevent any diseasehttps://redsupps.co.uk/products/100-noway-bodybalance-hcp-proteinhttps://cdn.shopify.com/s/files/1/2544/1734/products/Noway-Choc-website_600x600_crop_center.jpg?v=1543507113ATP Science new 1488867917875in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsBodybalance HCP Protein 44.99GBP shopify_1488867917875_13401183092787100% noway bodybalance hcp protein descriptionnoway is just that – no whey. for those that are ready to ditch the dairy, find they have a sensitive stomach and want the benefits of supplementing with collagen while filling in your protein requirements; then read about the research below on how collagen protein is beneficial for the body. bodybalance hydrolyzed bovine collagen is extracted at a particular temperature to keep the aminos and their peptide shuttle intact, they are semi digested from the process at which they are extracted making it extremely bio-efficient for processes in the body!noway bodybalance™whey protein has been the staple in gyms for decades for the growth of lean muscle tissue and for good reason. whey contains a high biologically active protein for muscle growth, is low in fat and carbohydrates and contains some natural growth factors. the great news is that scientific advancements have now taken protein supplements to the next level.  the decades of scientific research since whey hit the gyms has culminated in a vastly superior protein and collagen rich supplement that can boost your hard-earned muscle gain and fat loss results so as you can maximise your muscle gain and minimise your love handles.noway bodybalance™ has excellent bioavailability and bio-efficacynoway bodybalance™ is a unique combination of bioactive dietary peptides (very absorbable protein) from hydrolysed bovine collagen. what this means to you is that you will be taking the most biologically available protein, which has been already broken down in a vastly superior absorbable form to target your muscles for maximum growth. the bioactive peptides do not need to be digested further and are absorbed intact and delivered to your muscles where they work like a ‘lock and key’ to induce a specific function. the peptides then are broken down to release the amino acids at the target site. studies have found that you can achieve 3 x more muscle growth than whey, 2.5 x more fat loss than whey and 3.75 x more muscle power than whey.¹figure 1. the bioactive peptides are absorbed intact within minutes bypassing across the mucosal barrier as a complete peptide that is no longer subject to enzymatic cleavage.  this is rapidly followed by a high peak of systemic amino acids.noway bodybalance™ is made using a unique process recreating a digestive process with specific acids and enzymes capable of making a specific functioning blend. this means half the digestion work has been done for you! your body can then focus on getting the peptides and amino acids into the muscles where they belong for vastly better results than whey alone.feed collagenbut this is not simply a great form of protein. remember, whey is good but collagen protein is better. were you aware that collagen is the most abundant protein in the human body? 30-40% of all the protein in your body is made of collagen² noway bodybalance™ is a hydrolyzed collagen protein, meaning it feeds the 30-40% of your body protein whey barely touches, as well as the other 60-70%. this means better results, and given the hours you spend in the gym each week, you deserve them.did you know that less than 10% of your skeletal muscle mass is made up of collagen yet, 30% of your strength and power comes from this collagenous connective tissue? if it is power and performance that you are after, then you need to feed your collagen.figure 2. stimulation of connective tissue compared to whey.³every batch of noway bodybalance™ is tested to confirm the presence and activity of the specific protein peptides to ensure efficacy and consistency so you can rest easy knowing what is on the label is what you are really getting.collagen makes up 30-40% of the protein in the body.collagen is less than 10% of the muscle but generates 30% of strength and power.tendon: collagenous tissue that connects muscle and boneendomysium: collagenous tissue that wraps every single muscle fiberperimysium: collagenous connective tissue that bundles several muscle fibersepimysium: collagenous connective tissue that wraps the whole musclefascia: collagenous connective tissue that covers the entire muscle, located over the layer of epimysiumacid: base balance noway bodybalance™ alkalizing protein not alkaline proteinunique amino acid profile(these include high amounts of hydroxyproline, bioavailable arginine and glycine)hydroxyproline is unique to collagen.it is not found in whey or vegetable proteins. hydroxyproline is the major amino acids working with the bioactive peptides responsible for the enhanced collagen support seen with noway bodybalancehigh levels of bioavailable arginineas the collagen peptides are absorbed intact and the amino acids are liberated in the periphery; arginine can bypass the issues with oral absorption of l-arginine from the gut and deliver it directly to the peripheral tissue.arginine induces no vasodilation in the microvasculature of the musclearginine aids creatine synthesis and replenishmentarginine is involved in protein synthesishigh levels of glycineworks with arginine for creatine synthesisworks with the hydroxyproline for connective tissue synthesismost simple amino acid building block / precursor for several pathways involved in;antioxidant defence systemsglycogen replenishmentneurotransmitter functiondemonstrated in noway bodybalance™ scienceproper training can build muscleproper training with adequate macros (protein, fats and carbohydrates) improves your results from trainingmaking 15 grams of noway bodybalance™ part of your daily protein allocation can amplify your results significantly 3 x more muscle growth than whey 2.5 x more fat loss than whey 3.75 x more muscle power than whey4for optimal results, please consume noway bodybalance™ with a suitable nutrition and exercise program.these statements have not been evaluated by the food and drug administration. these products are not intended to diagnose, treat, cure, or prevent any diseasehttps://redsupps.co.uk/products/100-noway-bodybalance-hcp-proteinhttps://cdn.shopify.com/s/files/1/2544/1734/products/Noway-Choc-website_600x600_crop_center.jpg?v=1543507113ATP Science new 1488867917875in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsBodybalance HCP Protein 44.99GBP shopify_1488867917875_13401183125555100% noway bodybalance hcp protein descriptionnoway is just that – no whey. for those that are ready to ditch the dairy, find they have a sensitive stomach and want the benefits of supplementing with collagen while filling in your protein requirements; then read about the research below on how collagen protein is beneficial for the body. bodybalance hydrolyzed bovine collagen is extracted at a particular temperature to keep the aminos and their peptide shuttle intact, they are semi digested from the process at which they are extracted making it extremely bio-efficient for processes in the body!noway bodybalance™whey protein has been the staple in gyms for decades for the growth of lean muscle tissue and for good reason. whey contains a high biologically active protein for muscle growth, is low in fat and carbohydrates and contains some natural growth factors. the great news is that scientific advancements have now taken protein supplements to the next level.  the decades of scientific research since whey hit the gyms has culminated in a vastly superior protein and collagen rich supplement that can boost your hard-earned muscle gain and fat loss results so as you can maximise your muscle gain and minimise your love handles.noway bodybalance™ has excellent bioavailability and bio-efficacynoway bodybalance™ is a unique combination of bioactive dietary peptides (very absorbable protein) from hydrolysed bovine collagen. what this means to you is that you will be taking the most biologically available protein, which has been already broken down in a vastly superior absorbable form to target your muscles for maximum growth. the bioactive peptides do not need to be digested further and are absorbed intact and delivered to your muscles where they work like a ‘lock and key’ to induce a specific function. the peptides then are broken down to release the amino acids at the target site. studies have found that you can achieve 3 x more muscle growth than whey, 2.5 x more fat loss than whey and 3.75 x more muscle power than whey.¹figure 1. the bioactive peptides are absorbed intact within minutes bypassing across the mucosal barrier as a complete peptide that is no longer subject to enzymatic cleavage.  this is rapidly followed by a high peak of systemic amino acids.noway bodybalance™ is made using a unique process recreating a digestive process with specific acids and enzymes capable of making a specific functioning blend. this means half the digestion work has been done for you! your body can then focus on getting the peptides and amino acids into the muscles where they belong for vastly better results than whey alone.feed collagenbut this is not simply a great form of protein. remember, whey is good but collagen protein is better. were you aware that collagen is the most abundant protein in the human body? 30-40% of all the protein in your body is made of collagen² noway bodybalance™ is a hydrolyzed collagen protein, meaning it feeds the 30-40% of your body protein whey barely touches, as well as the other 60-70%. this means better results, and given the hours you spend in the gym each week, you deserve them.did you know that less than 10% of your skeletal muscle mass is made up of collagen yet, 30% of your strength and power comes from this collagenous connective tissue? if it is power and performance that you are after, then you need to feed your collagen.figure 2. stimulation of connective tissue compared to whey.³every batch of noway bodybalance™ is tested to confirm the presence and activity of the specific protein peptides to ensure efficacy and consistency so you can rest easy knowing what is on the label is what you are really getting.collagen makes up 30-40% of the protein in the body.collagen is less than 10% of the muscle but generates 30% of strength and power.tendon: collagenous tissue that connects muscle and boneendomysium: collagenous tissue that wraps every single muscle fiberperimysium: collagenous connective tissue that bundles several muscle fibersepimysium: collagenous connective tissue that wraps the whole musclefascia: collagenous connective tissue that covers the entire muscle, located over the layer of epimysiumacid: base balance noway bodybalance™ alkalizing protein not alkaline proteinunique amino acid profile(these include high amounts of hydroxyproline, bioavailable arginine and glycine)hydroxyproline is unique to collagen.it is not found in whey or vegetable proteins. hydroxyproline is the major amino acids working with the bioactive peptides responsible for the enhanced collagen support seen with noway bodybalancehigh levels of bioavailable arginineas the collagen peptides are absorbed intact and the amino acids are liberated in the periphery; arginine can bypass the issues with oral absorption of l-arginine from the gut and deliver it directly to the peripheral tissue.arginine induces no vasodilation in the microvasculature of the musclearginine aids creatine synthesis and replenishmentarginine is involved in protein synthesishigh levels of glycineworks with arginine for creatine synthesisworks with the hydroxyproline for connective tissue synthesismost simple amino acid building block / precursor for several pathways involved in;antioxidant defence systemsglycogen replenishmentneurotransmitter functiondemonstrated in noway bodybalance™ scienceproper training can build muscleproper training with adequate macros (protein, fats and carbohydrates) improves your results from trainingmaking 15 grams of noway bodybalance™ part of your daily protein allocation can amplify your results significantly 3 x more muscle growth than whey 2.5 x more fat loss than whey 3.75 x more muscle power than whey4for optimal results, please consume noway bodybalance™ with a suitable nutrition and exercise program.these statements have not been evaluated by the food and drug administration. these products are not intended to diagnose, treat, cure, or prevent any diseasehttps://redsupps.co.uk/products/100-noway-bodybalance-hcp-proteinhttps://cdn.shopify.com/s/files/1/2544/1734/products/Noway-Choc-website_600x600_crop_center.jpg?v=1543507113ATP Science new 1488867917875in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsBodybalance HCP Protein 44.99GBP shopify_1488867917875_15534223327283100% noway bodybalance hcp protein descriptionnoway is just that – no whey. for those that are ready to ditch the dairy, find they have a sensitive stomach and want the benefits of supplementing with collagen while filling in your protein requirements; then read about the research below on how collagen protein is beneficial for the body. bodybalance hydrolyzed bovine collagen is extracted at a particular temperature to keep the aminos and their peptide shuttle intact, they are semi digested from the process at which they are extracted making it extremely bio-efficient for processes in the body!noway bodybalance™whey protein has been the staple in gyms for decades for the growth of lean muscle tissue and for good reason. whey contains a high biologically active protein for muscle growth, is low in fat and carbohydrates and contains some natural growth factors. the great news is that scientific advancements have now taken protein supplements to the next level.  the decades of scientific research since whey hit the gyms has culminated in a vastly superior protein and collagen rich supplement that can boost your hard-earned muscle gain and fat loss results so as you can maximise your muscle gain and minimise your love handles.noway bodybalance™ has excellent bioavailability and bio-efficacynoway bodybalance™ is a unique combination of bioactive dietary peptides (very absorbable protein) from hydrolysed bovine collagen. what this means to you is that you will be taking the most biologically available protein, which has been already broken down in a vastly superior absorbable form to target your muscles for maximum growth. the bioactive peptides do not need to be digested further and are absorbed intact and delivered to your muscles where they work like a ‘lock and key’ to induce a specific function. the peptides then are broken down to release the amino acids at the target site. studies have found that you can achieve 3 x more muscle growth than whey, 2.5 x more fat loss than whey and 3.75 x more muscle power than whey.¹figure 1. the bioactive peptides are absorbed intact within minutes bypassing across the mucosal barrier as a complete peptide that is no longer subject to enzymatic cleavage.  this is rapidly followed by a high peak of systemic amino acids.noway bodybalance™ is made using a unique process recreating a digestive process with specific acids and enzymes capable of making a specific functioning blend. this means half the digestion work has been done for you! your body can then focus on getting the peptides and amino acids into the muscles where they belong for vastly better results than whey alone.feed collagenbut this is not simply a great form of protein. remember, whey is good but collagen protein is better. were you aware that collagen is the most abundant protein in the human body? 30-40% of all the protein in your body is made of collagen² noway bodybalance™ is a hydrolyzed collagen protein, meaning it feeds the 30-40% of your body protein whey barely touches, as well as the other 60-70%. this means better results, and given the hours you spend in the gym each week, you deserve them.did you know that less than 10% of your skeletal muscle mass is made up of collagen yet, 30% of your strength and power comes from this collagenous connective tissue? if it is power and performance that you are after, then you need to feed your collagen.figure 2. stimulation of connective tissue compared to whey.³every batch of noway bodybalance™ is tested to confirm the presence and activity of the specific protein peptides to ensure efficacy and consistency so you can rest easy knowing what is on the label is what you are really getting.collagen makes up 30-40% of the protein in the body.collagen is less than 10% of the muscle but generates 30% of strength and power.tendon: collagenous tissue that connects muscle and boneendomysium: collagenous tissue that wraps every single muscle fiberperimysium: collagenous connective tissue that bundles several muscle fibersepimysium: collagenous connective tissue that wraps the whole musclefascia: collagenous connective tissue that covers the entire muscle, located over the layer of epimysiumacid: base balance noway bodybalance™ alkalizing protein not alkaline proteinunique amino acid profile(these include high amounts of hydroxyproline, bioavailable arginine and glycine)hydroxyproline is unique to collagen.it is not found in whey or vegetable proteins. hydroxyproline is the major amino acids working with the bioactive peptides responsible for the enhanced collagen support seen with noway bodybalancehigh levels of bioavailable arginineas the collagen peptides are absorbed intact and the amino acids are liberated in the periphery; arginine can bypass the issues with oral absorption of l-arginine from the gut and deliver it directly to the peripheral tissue.arginine induces no vasodilation in the microvasculature of the musclearginine aids creatine synthesis and replenishmentarginine is involved in protein synthesishigh levels of glycineworks with arginine for creatine synthesisworks with the hydroxyproline for connective tissue synthesismost simple amino acid building block / precursor for several pathways involved in;antioxidant defence systemsglycogen replenishmentneurotransmitter functiondemonstrated in noway bodybalance™ scienceproper training can build muscleproper training with adequate macros (protein, fats and carbohydrates) improves your results from trainingmaking 15 grams of noway bodybalance™ part of your daily protein allocation can amplify your results significantly 3 x more muscle growth than whey 2.5 x more fat loss than whey 3.75 x more muscle power than whey4for optimal results, please consume noway bodybalance™ with a suitable nutrition and exercise program.these statements have not been evaluated by the food and drug administration. these products are not intended to diagnose, treat, cure, or prevent any diseasehttps://redsupps.co.uk/products/100-noway-bodybalance-hcp-proteinhttps://cdn.shopify.com/s/files/1/2544/1734/products/Noway-Choc-website_600x600_crop_center.jpg?v=1543507113ATP Science new 1488867917875in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsBodybalance HCP Protein 44.99GBP shopify_473656557605_52375794483573-whey 2lbs 3-whey protein blend3 types of blended proteinhelps build muscle and strength descriptionrefuel your muscles with 3-whey, a protein unlike any you’ve tried before. 3-whey contains a trio of ultra-effective, highly bioavailable whey proteins your muscles need to repair, rebuild, and grow following intense training. ingredientsprotein blend 3-whey uses a precisely formulated threesome of proteins in whey protein hydrolysate, whey protein isolate, and whey protein concentrate to infuse your muscles with a monster load of muscle-building amino acids, stimulating protein synthesis, muscle growth, and recovery. instructionsas a dietary supplement, mix one (1) scoop of 3-whey with 6-8 oz. of water.https://redsupps.co.uk/products/3-wheyhttps://cdn.shopify.com/s/files/1/2544/1734/products/3whey-chocolate_fb845b03-af50-4661-83ed-af8e1073e772_600x600_crop_center.png?v=1543507123Blackstone Labs new 473656557605in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Blend 29.00GBP shopify_473656557605_80283945206273-whey 2lbs 3-whey protein blend3 types of blended proteinhelps build muscle and strength descriptionrefuel your muscles with 3-whey, a protein unlike any you’ve tried before. 3-whey contains a trio of ultra-effective, highly bioavailable whey proteins your muscles need to repair, rebuild, and grow following intense training. ingredientsprotein blend 3-whey uses a precisely formulated threesome of proteins in whey protein hydrolysate, whey protein isolate, and whey protein concentrate to infuse your muscles with a monster load of muscle-building amino acids, stimulating protein synthesis, muscle growth, and recovery. instructionsas a dietary supplement, mix one (1) scoop of 3-whey with 6-8 oz. of water.https://redsupps.co.uk/products/3-wheyhttps://cdn.shopify.com/s/files/1/2544/1734/products/3whey-chocolate_fb845b03-af50-4661-83ed-af8e1073e772_600x600_crop_center.png?v=1543507123Blackstone Labs new 473656557605in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Blend 29.00GBP shopify_473656557605_52375793828213-whey 2lbs 3-whey protein blend3 types of blended proteinhelps build muscle and strength descriptionrefuel your muscles with 3-whey, a protein unlike any you’ve tried before. 3-whey contains a trio of ultra-effective, highly bioavailable whey proteins your muscles need to repair, rebuild, and grow following intense training. ingredientsprotein blend 3-whey uses a precisely formulated threesome of proteins in whey protein hydrolysate, whey protein isolate, and whey protein concentrate to infuse your muscles with a monster load of muscle-building amino acids, stimulating protein synthesis, muscle growth, and recovery. instructionsas a dietary supplement, mix one (1) scoop of 3-whey with 6-8 oz. of water.https://redsupps.co.uk/products/3-wheyhttps://cdn.shopify.com/s/files/1/2544/1734/products/3whey-chocolate_fb845b03-af50-4661-83ed-af8e1073e772_600x600_crop_center.png?v=1543507123Blackstone Labs new 473656557605in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Blend 29.00GBP shopify_473656557605_80283987804673-whey 2lbs 3-whey protein blend3 types of blended proteinhelps build muscle and strength descriptionrefuel your muscles with 3-whey, a protein unlike any you’ve tried before. 3-whey contains a trio of ultra-effective, highly bioavailable whey proteins your muscles need to repair, rebuild, and grow following intense training. ingredientsprotein blend 3-whey uses a precisely formulated threesome of proteins in whey protein hydrolysate, whey protein isolate, and whey protein concentrate to infuse your muscles with a monster load of muscle-building amino acids, stimulating protein synthesis, muscle growth, and recovery. instructionsas a dietary supplement, mix one (1) scoop of 3-whey with 6-8 oz. of water.https://redsupps.co.uk/products/3-wheyhttps://cdn.shopify.com/s/files/1/2544/1734/products/3whey-chocolate_fb845b03-af50-4661-83ed-af8e1073e772_600x600_crop_center.png?v=1543507123Blackstone Labs new 473656557605in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Blend 29.00GBP shopify_473656557605_84569291817473-whey 2lbs 3-whey protein blend3 types of blended proteinhelps build muscle and strength descriptionrefuel your muscles with 3-whey, a protein unlike any you’ve tried before. 3-whey contains a trio of ultra-effective, highly bioavailable whey proteins your muscles need to repair, rebuild, and grow following intense training. ingredientsprotein blend 3-whey uses a precisely formulated threesome of proteins in whey protein hydrolysate, whey protein isolate, and whey protein concentrate to infuse your muscles with a monster load of muscle-building amino acids, stimulating protein synthesis, muscle growth, and recovery. instructionsas a dietary supplement, mix one (1) scoop of 3-whey with 6-8 oz. of water.https://redsupps.co.uk/products/3-wheyhttps://cdn.shopify.com/s/files/1/2544/1734/products/3whey-chocolate_fb845b03-af50-4661-83ed-af8e1073e772_600x600_crop_center.png?v=1543507123Blackstone Labs new 473656557605in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Blend 29.00GBP shopify_473656557605_129287646740993-whey 2lbs 3-whey protein blend3 types of blended proteinhelps build muscle and strength descriptionrefuel your muscles with 3-whey, a protein unlike any you’ve tried before. 3-whey contains a trio of ultra-effective, highly bioavailable whey proteins your muscles need to repair, rebuild, and grow following intense training. ingredientsprotein blend 3-whey uses a precisely formulated threesome of proteins in whey protein hydrolysate, whey protein isolate, and whey protein concentrate to infuse your muscles with a monster load of muscle-building amino acids, stimulating protein synthesis, muscle growth, and recovery. instructionsas a dietary supplement, mix one (1) scoop of 3-whey with 6-8 oz. of water.https://redsupps.co.uk/products/3-wheyhttps://cdn.shopify.com/s/files/1/2544/1734/products/3whey-chocolate_fb845b03-af50-4661-83ed-af8e1073e772_600x600_crop_center.png?v=1543507123Blackstone Labs new 473656557605in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Blend 29.00GBP shopify_369643651109_4714190503973Abnormal  key featurespro anabolic precursorwomen safetime-released delivery system descriptionyou know blackstone labs is anything but normal. we push the extremes in everything we do, and it’s only fitting that we’ve created the ultimate abnormal muscle builder. abnormal is an incredibly powerful 19-nordhea supplement offering superior bioavailability for maximum muscle growth and increased testosterone production. ingredients19-nor dhea blend (50mg) abnormal includes not one but three highly effective forms of 19-nordhea (19-norandrost-4 ene-3b-ol,17-one). 19-nordhea is the precursor to nandrolone (“deca”), one of the most powerful and popular anabolics of all time. 19-nordhea converts to norandrostenediol, which is 6 times more anabolic than testosterone, meaning you get 6 times more muscle growth that using regular muscle builders. plus, we’ve included our signature ester delivery system providing sustained release of 19-nordhea, throughout your entire cycle. more muscle building, more testosterone, more results -- being abnormal is a great thing!  directionsas a dietary supplement, take one (1) tablet two (2) times per day. do not exceed two (2) tablets daily.https://redsupps.co.uk/products/blackstone-labs-abnormal-60tab-abnormal-by-choice-massive-gainshttps://cdn.shopify.com/s/files/1/2544/1734/products/abNORmal_ffabe8ec-0ce9-4e8c-913f-ef95eb57476d_600x600_crop_center.png?v=1543507138Blackstone Labs new 369643651109in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Builder 49.99GBP shopify_719609200691_8548135010355Adam descriptionwith saw palmetto, plant sterols, lycopene, nettle root & coq10gentler and easier to swallow & absorba dietary supplementvitaminsfamily owned since 1968quality gmp assuredthese multi-vitamin softgels are easier to swallow, and are formulated for better gi tolerability. suggested usetake 2 softgels daily with food. other ingredientssoftgel capsule (bovine gelatin, glycerin, water, carob), pumpkin seed oil, sunflower lecithin, beeswax, and cinnamon (cinnamomum cassia) (bark) oil.contains soy. https://redsupps.co.uk/products/adam-180-softgels-1https://cdn.shopify.com/s/files/1/2544/1734/products/adam_600x600_crop_center.jpg?v=1543507141NOW FOODS new 719609200691in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMultivitamin 35.99GBP shopify_706178842675_8461480820787Adrenal care benefitssupports healthy and optimal adrenal gland functionsupports healthy cortisol levels descriptionadrenal fatigue is a collection of symptoms that can occur when your level of stress – whether it is physical, emotional, mental, or a combination – overwhelms your body's ability to compensate for that stress. adrenal care is designed to give your body what it needs to fight back against the physical symptoms of stress and help normalize your tolerance to stress-inducing stimulants.stress hits us all, some more than others. stress can essentially strip all of the nutrients away from where it's needed, like building important regulatory hormones. our adrenal hormones are needed in order to regulate our complicated day to day processes, staying focused, and sleep properly. blackstone labs set out to support these adrenal hormones with its proprietary, cutting-edge formula, adrenal care. blackstone labs specifically designed adrenal care to promote sound hpa axis gland structure and adrenal fatigue recovery.it contains important compounds that are required in adrenal hormone synthesis and energy production†it's formulated with optimal bioavailability of its active constituents †adrenal care has unique nutrient amounts for effective support during stress and adrenal fatigue†it's synergistic combination enhances efficacy of individual nutrients†its unique protein-based building blocks for sound hpa axis gland structure are able to sustain healthy functions†supports brain health and cognitive health†adrenal care by blackstone labs is the foremost adrenal support product available today. adrenal care supports the building of these regulating hormones with the raw materials it needs and gives you that extra balance you need to stay feeling great. adrenal glandulars are adrenal supplements made up of actual adrenal gland tissue. adrenal care provides the support your adrenals need to repair themselves and return to normal function. adrenal care should be your first choice of adrenal support supplements for mild to moderate cases of adrenal fatigue. ingredientszinc (30mg)one of the 24 micronutrients needed for survival, zinc benefits everything from testosterone to immune function.inositol hexanicotinate (750mg)inositol hexanicotinate (inh), often marketed as "no flush" niacin, allows you to derive the substantial metabolic benefits of niacin (vit. b3) without the uncomfortable flushing sensation that often accompanies supplemental niacin.dmae (750mg)dmae (dimethylaminoethanol) can readily cross the blood brain barrier where it then acts as both a protective compound and helps the body synthesize its primary neurotransmitter, acetylcholine. dmae supplementation has shown a variety of therapeutic benefits for cognitive disorders like attention-deficit hyperactivity disorder and memory lapses.bovine adrenal gland extract (500mg)glandular extracts come from the hormone-producing glands of animals and are beneficial for individuals not getting adequate daily nutrients—particularly those that support the adrenal and thyroid glands. glandular extracts often have a tonic effect on the body by correcting deficiencies of limiting adrenal nutrients required for the synthesis of protective or energetic hormones.magnesium glycinate (300mg)magnesium is the second most prevalent electrolyte in the human body, an essential dietary mineral, and (perhaps most importantly) the most commonly deficient mineral in the standard american diet. in the context of the adrenals, magnesium helps the body, from its muscles down to its literal cells, relax. relaxed cells are able to then achieve a high-energy state associated with rest and repair. overstimulated cells are calcium dominant, and the magnesium displaces the calcium. in states of adrenal fatigue, cells are chronically overstimulated and thus exhausted. magnesium counteracts this overexcited state. this particular form of magnesium, glycinate, is readily absorbed from the intestine and less likely to produce gastrointestinal side-effects like diarrhea and bloating.glycyrrhetinic acid (licorice extract) (200mg)glycyrrhetinic acid inhibits both 11β-hydroxysteroid dehydrogenase enzymes (type 1 and type 2, the enzymes that control cortisol levels), with slightly more effect on the type i (anti-cortisol) than type ii (pro-cortisol). therefore, the net effect is a reduction in serum cortisol (a stress hormone that is chronically elevated in those with adrenal fatigue). the decrease in cortisol increase has been noted to be 39-50% after 3-500mg glycyrrhetinic acid (the active ingredient in adrenal care)—which is substantial. in other words, the glycyrrhetinic acid in adrenal care can potentially cut your stress levels (as measured by cortisol) in half.korean ginseng (1% eleutherosides) (100mg)an herb used in traditional chinese medicine (tcm) for thousands of years, eleutherococcus reduces lethargy and fatigue, improves stamina and endurance, and boosts resilience to environmental stressors.huperzine a (huperzia serrata) (moss) (300mcg)huperzine a's most recognized and desired action is inhibiting the acetylcholinesterase enzyme. this effect, coupled with co-ingestion of a choline donor like the dmae in adrenal care, prolongs and magnifies the benefits. in addition to positive effects on mood and muscle contraction, huperzine a can even improve learning. instructionsas a dietary supplement, take two (2) twice daily. do not exceed four (4) tablets daily. finish entire contents of bottle over a thirty (30) day period.https://redsupps.co.uk/products/adrenal-care-120tabhttps://cdn.shopify.com/s/files/1/2544/1734/products/adrenalcare_600x600_crop_center.png?v=1543507146Blackstone Labs new 706178842675in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAdrenal support 34.99GBP shopify_1487404859443_13390777450547Alpha mars descriptionalpha mars is a great way to naturally increase healthy levels of testosterone in the body while also freeing up what may be bound up. in the process of building and freeing up testosterone in the body it may also assist in blocking the conversion of testosterone to estrogen in males via inhibition of aromatase activity, while assisting in blocking the conversion to dht via the 5 alpha-reductase enzyme pathways; keeping testosterone levels healthy and primed. it also supports overall vitality, normal immune function and natural energy production by supporting mitochondrial function.* ingredientsshilajitshilajit is one of the most powerful ingredient for building and rebuilding, anti-fatigue, anti-aging purposes and improving resilience to anything that life can throw at you. traditionally shilajit is used as a panacea for all disease as well as a rasayana (rejuvenator) with promises to increase wellness. shilajit is aptly referred to as ‘rasayana’/’rasayanam’ in ayurveda and siddha literature which means rejuvenator because it prevents ailment and enhances the quality of life.what can shilajit do for you?boost testosterone by >20%increase sperm production by >35% and sperm movement by >60%increase energy production in mitochondriapanax ginsengpanax ginseng is the one “true” ginseng of the ginseng family. panax can provide the following benefitsnitric oxide (no) vasodilationimprove erections as treatment for erectile dysfunctionboost testosterone productionimprove vitality, motivation and drivesupport immune systemanti-aging propertiesimprove psychomotor performance including attention, processing and auditory reaction timenettlesnettles are an essential edition to any testosterone boosting supplement. here are the mechanisms of action for nettle.inhibits 5-alpha reductase conversion of testosterone to dhtinhibits the aromatase conversion of testosterone to estrogeninhibits inflammation, allergies and immune dysfunctionincreases sperm and testosterone productionfenugreek (trigonella foenum-graecum)traditionally used to improve liver function, reduce blood sugar and fat, prevent brain ischemia, improve memory, and as an anti-inflammatory. other functions of fenugreek for testosterone support are as follows.fenugreek furostanol saponins can boost testosterone and improve endurance.boost free testosterone by lowering shgbinhibits aromatase and 5 alpha reductase conversion of testosterone to estrogen and dihydrotestosterone respectively   tong kat ali (eurycoma longifolia)often called “malaysian ginseng”, is traditionally used as a general health tonic, improving physical and mental energy levels and overall quality of life; as an adaptogen and as a traditional “anti-aging” remedy to help older individuals adapt to the reduced energy, mood, and libido that often comes with age.what tongkat ali can do for you:increase anabolic hormones, such as testosterone and dhea and reduce the catabolic hormone cortisolboost testosterone productionmake free testosterone in men and womenreduce shbghttps://redsupps.co.uk/products/alpha-marshttps://cdn.shopify.com/s/files/1/2544/1734/products/Mars-front_600x600_crop_center.jpg?v=1543507159ATP Science new 1487404859443in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsTestosterone Booster 49.99GBP shopify_1487425798195_13391150350387Alpha prime descriptionalpha primealpha prime has been formulated to improve your androgen to estrogen ratio. increasing the androgen: estrogen ratio enhances fat loss whilst increasing lean muscle mass.alpha prime contains the following natural ingredients that are specifically formulated to reduce oestrogen levels:brassica oleracea (broccoli) sproutmodifies phase 1 cyp450 enzymes to increases the good 2α-hydroxyestrone production and reduces the bad 16α-hydroxyestroneincreases phase 2 conjugation of estrogen through glucuronidation, glutathionation, methylation and sulfation.quenches reactive quinones formed by the potentially dangerous 4α-hydroxyestrone pathwaybroccoli sprouts contain a multitude of beneficial phytonutrients, activated vitamins and cofactors.nrf2 activator (antioxidant)rosmarinus officinalis (rosemary) extractworks synergistically with sulforaphane to balance phase 1 and stimulate phase 2 detoxification pathways.modifies phase 1 detoxification pathways to switch off the 16α-hydroxyestrone pathway and up-regulate the 2α-hydroxyestrone pathwayenhances phase 2 conjugation reactions glutathionation and glucuronidation.an nrf2 activator (a potent antioxidant inducer)fucus vesiculosus (bladderwrack) extractexerts anti-estrogenic effectsacts as an aromatase inhibitorinhibits the binding of estradiol to estrogen receptorsa reliable source of iodineeurycoma longifolia (tongkat ali) root extractthese statements have not been evaluated by the food and drug administration. these products are not intended to diagnose, treat, cure, or prevent any disease“i almost have the whole shop now. been using them for almost 6 months and a lot of people have noticed the change in my body shape due to my high estrogen locked away in my fat cells which has now dropped from using alpha prime/alpha venus and block e3. also check out their podcast atp project. so much general health information :-)” – mandi leeit is best to avoid excessive estrogens in the body in the first place. most excessive estrogens come from carrying too much body fat. thus, the obvious strategy to reduce estrogens is to work with your coach, trainer and/ or healthcare provider to remove excess body fat. other sources include the environmental exposure to plastics, pollutants and chemicals in medications and cosmetics. if these factors are a part of your life and you have some of the oestrogen dominant symptoms, then consider supplementing with alpha prime. https://redsupps.co.uk/products/alpha-primehttps://cdn.shopify.com/s/files/1/2544/1734/products/Prime-front_600x600_crop_center.jpg?v=1543507167ATP Science new 1487425798195in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsEstrogen-Androgen Balance 49.99GBP shopify_1487408431155_13390830895155Alpha venus descriptionalpha venus was made for women and just to prove that, we put a pretty pink stripe on the bottle. every woman knows that we have it harder than men – we put up with a lot, men for example and other issues like monthly hormonal fluctuations. we can’t help you with the men, but we can help you feel and look better and improve those hormonal fluctuations that drive weight gain in the form of fluid and fat. this may be “normal”, but not exactly ideal is it? alpha venus is creating a “new normal” which is why women love alpha venus. so why not feel and look the best you can? you deserve it.alpha venus is formulated for women that have an excess of oestrogen in their body and a lack of progesterone.estrogen dominanceestrogen is an essential hormone for health and wellness in both men and women; but you can get too much of a good thing. signs and symptoms of excess estrogenestrogen body shapeestrogen holds subcutaneous fat and fluid in these areashipsbuttocksthighsbreasts and chestbacks of the armslove handleslower backlower abdomenpoor muscle mass and qualitypoor muscle definitionexcessive subcutaneous and intramuscular fatthe following are a list of symptoms of estrogen dominanceincreased worry, intuition and gut instinctsexaggerated stress response and harder to switch off so can dwell on thingsgood long term memory with poor short term memoryrunning on ‘autopilot’ most of the timecan crave sugar and chocolatemood swings are aggravated and follow pattern with menstrual cycle or mooncan trigger headaches and migrainespoor circulation, sometimes bruising and varicose veinsbloated and “fluidy” abdomen, hips and thighs.fluid retentionbreast lumps and bumpsban increased risk of blood clots, dvts, bruising and crampspoor blood sugar control – high or low blood sugar, leading to sweet cravingscellulite and obesityemotional, nervous and sleep disturbancesconditions such as endometriosis or endomyositisexcessive period painpmt with excessive emotional and mood fluctuationsheavy periodsutis and thrushthere are numerous causes of estrogen dominance. here are some of the causes of estrogen dominanceinefficient estrogen detoxification and eliminationexcessive endogenous estrogen production due toexcessive fat massincreased aromatase activity converting testosterone to estrogenother hormonal imbalances i.e. hypothyroidism and hypercortisolaemiaexcessive exogenous estrogen exposure and accumulation fromplasticspesticidesfertilizerspetrochemicalspollutionfoodscosmetics and sunscreensgeneticsfamily history of estrogen dominanceinherited genetic mthfr gene polymorphismshrt and certain oral contraceptive pills“xenestrogens” and edc’s (endocrine disrupting chemicals)iodine deficiency and / or hypothyroidismdetoxify estrogen excessit is important to understand that it is essential for health and wellness to allow the body to make and use endogenous estrogen (endogenous estrogen is the term used for estrogen made by our body) for healthy bodily functions and general maintenance. however, after estrogen has done its job, it must be cleared efficiently so as to not accumulate. any xenestrogens (estrogen and edc’s endocrine disrupting chemicals from outside our body i.e. pollutants, plastics etc.) and exogenous estrogens (estrogen supplemented from outside our body i.e. hrt, bio-identical hormones) must also be effectively eliminated to prevent accumulation.the elimination pathways can determine the fate of this estrogen and whether it can be converted to a beneficial form of estrogen that protects women from estrogen dominant disease states; or if it is converted to a more toxic form of estrogen that accumulates and contributes to the negative health implications of estrogen dominance.detoxification pathwaysdetoxification and elimination is a very complex process. our detoxification and elimination systems of our body is designed for general clean up and maintenance of our body but also is a very important part of our innate survival mechanism and must quickly respond to poisons, venoms and toxins.phase 1 and phase 2 liver detoxification – the basicsphase 1: detoxification involves a group of enzymes known as cytochrome p450’s (cyp450) that help to convert toxins into a water-soluble form so it is capable of being eliminated. this is an innate process we are born with to help us deal with poisons, venoms and toxic exposure.phase 2: detoxification involves conjugation reactions, which basically deactivate the water-soluble toxin so it is no longer biologically active and it cannot be reabsorbed and accumulate in your body and is then eliminated.if phase 1 detoxification pathways are out of balance than your body can be converting toxins, hormones, medicines, drugs and foods into a more toxic form that is not capable of being deactivated by the phase 2 conjugation reactions. this can lead to accumulation of toxic waste.specific manipulation of detoxification pathways to clear estrogen are via the phase 1 pathways. in layman’s terms, there are three pathways for estrogen detoxification. they are termed the ‘good, the bad and the ugly’ phase 1 pathways for estrogen detox.‘the good, the bad and the ugly’ phase 1 pathwaysthe pathway that leads to 2α-hydroxyestrone is good. 2α-hydroxyestrone works as an anti-estrogen; blocking and protecting you from excessive estrogen activity from 16α-hydroxyestrone.the pathway that leads to 16α-hydroxyestrone is bad. 16α-hydroxyestrone has excessive estrogen activity and is very hard to eliminate from the body.the pathway that leads to 4α-hydroxyestrone is ugly. it can contribute to the generation of other toxic and cancer causing compounds such as reactive quinones.the ratio between the 2α-hydroxyestrone: 16α-hydroxyestrone can determine your risk and be used as a marker to assess estrogen dominance.estrogen detox strategyavoid exposure and isolate and address your cause (e.g. obesity or hypothyroid function)block the pathways that make the 4α-hydroxy and 16α-hydroxy forms; while up regulating the pathway that makes 2α-hydroxy formstimulate phase 2 conjugation reactions to deactivate and eliminatenutrients found in alpha venusbrassica oleracea (broccoli) sproutmodifies phase 1 cyp450 enzymes to increases the good 2α-hydroxyestrone production and reduces the bad 16α-hydroxyestroneincreases phase 2 conjugation of estrogen through glucuronidation, glutathionation, methylation and sulfationquenches reactive quinones formed by the ugly 4α-hydroxyestrone pathwaybroccoli sprouts contain a multitude of beneficial phytonutrients, activated vitamins and cofactorsboosts levels of nrf2nrf2 – boosts antioxidant statusnrf2 is a powerful protein that lies dormant within each cell of our body. nrf2 remains latent and unable to move or operate until it is released by an nrf2 activator. once released it migrates into the cell nucleus and bonds to the dna at the location of the antioxidant response element (are) or also called hare (human antioxidant response element) which is the master regulator of the total antioxidant system that is available in all human cells.nrf2 activating foods such as broccoli sprouts and rosemary can trigger the production of thousands of antioxidant molecules, providing far better protection against free radicals compared to standard antioxidant supplements.rosmarinus officinalis (rosemary) extractworks synergistically with sulforaphane to balance phase 1 and stimulate phase 2 detoxification pathways.modifies phase 1 detoxification pathways to switch off the 16α-hydroxyestrone pathway and up-regulate the 2α-hydroxyestrone pathwayenhances phase 2 conjugation reactions glutathionation and glucuronidation¹rosemary helps with moodinessrosemary helps in raising mood, improving memory and cognition and also helps to regulate cortisol secretions and reducing excessive cortisol associated with anxiety, stress and depression.²rosemary boosts parasympathetic nervous systemrosemary improves focus, concentration and memory by boosting the parasympathetic nervous system through inhibition of acetylcholine esterase and subsequent pooling of acetylcholine in nerve synapses.³rosemary also boosts healthy androgens: free testosterone, dhea and progesteroneworks synergistically with sulforaphane to balance phase 1 and stimulate phase 2 detoxification pathways.modifies phase 1 detoxification pathways to switch off the 16α-hydroxyestrone pathway and up-regulate the 2α-hydroxyestrone pathwayenhances phase 2 conjugation reactions glutathionation and glucuronidation.nrf2 activatorfucus vesiculosus (bladderwrack) extractexerts anti-estrogenic effectsaromatase inhibitor (regulates the conversion of testosterone to estrogen)beta glucuronidase inhibitor to aid efficient elimination of estrogeninhibits the binding of oestradiol to estrogen receptorssource of iodinevitex agnus castusalpha venus summarythere are many estrogen dominant women. if you feel you have some of the symptoms mentioned here or you have the tell-tale body signs of estrogen dominance, consider making alpha venus part of your daily regime to help your body naturally balance its hormones. alpha venus contains the latest scientifically formulated and most potent form of natural medicines to help you achieve your health goals. if you have any doubt about taking such a product, please check with your health care professional to determine if you have estrogen dominance.https://redsupps.co.uk/products/alpha-venushttps://cdn.shopify.com/s/files/1/2544/1734/products/Venus-front_600x600_crop_center.jpg?v=1542781316ATP Science new 1487408431155in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsEstrogen Control 49.99GBP shopify_711027916851_8489343221811Altrient alc liposomal acetyl l-carnitine  descriptionif you want to raise your energy levels, maintain mental clarity, look after your heart and decrease your risk of type diabetes - look no further. carnitine could help to put the brakes on the ageing process.it plays a crucial role in the production of energy in the mitochondria - the powerhouses of the cells, where it transports long-chain fatty acids to be burned or ‘oxidised ’ to produce energy.not only does carnitine increase the mitochondria’s potential to burn fat, acetyl l-carnitine (alc) is also known for its ability to optimize brain function because it can cross into the brain more effectively than regular carnitine.while in the brain, alc helps protect nerve cells from losing receptors that allow neurons in the brain to communicate effectively with one another. it supports the natural production of acetylcholine, an important neurotransmitter.plays a critical role in turning fat into energyhelps maintain normal cognitive functioning of the brainacts as an antioxidant, helping to reduce oxidative stress and inflammationcontributes to the normal functioning of muscle metabolism and performancehelps to protect cardiovascular health  altrient alc nutritional factsserving size: 1 sachet (5.7ml) servings per container: 30amount per serving % rda*acetyl l-carnitine1000 mg†phospholipids1000 mg†of which phosphatidylcholine500 mg†* recommended daily allowance †rda not establishedingredients: deionized water, acetyl l-carnitine, lecithin phospholipids, alcohol, potassium hydroxide chloride (ph adjustment), xanthum gum.contains no sugar, no starch, no artificial flavours, no artificial colours, no meat products, no dairy products, no wheat, no gluten and no yeast.  dosage as a dietary supplement take 1-2 sachets per day.higher therapeutic doses may be necessary, take advice from your doctor or health practitioner.if you are pregnant or breastfeeding, consult a healthcare practitioner before using this product.for best results, snip or tear the notched end off the sachet, squeeze the gel contents into a small amount of water or your favourite cool beverage and shot it down quickly.to speed up absorption drink on an empty stomach, and wait at least 15 minutes before eating. storage store in a cool, dry place, can be refrigerated.do not freeze or place the product in direct sunlight for extended periods of time. https://redsupps.co.uk/products/altrient-alc-liposomal-acetyl-l-carnitinehttps://cdn.shopify.com/s/files/1/2544/1734/products/altrient-alc-liposomal-acetyl-l-carnitine-livon-labs_600x600_crop_center.jpg?v=1543507213Livon new 711027916851in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIPOSOMAL ACETYL L-CARNITINE 54.99GBP shopify_710941540403_8489053159475Altrient b liposomal vitamin b  descriptionmost ordinary forms of b complex vitamins – tablets, capsules, powders, liquids and even dietary sources are not retained fully by the body. it can only store limited amounts of b vitamins because they are all water-soluble, and therefore any excess is excreted in the urine. finding a supplement that provides highly bioavailable b vitamins is crucial for the body to maintain its energy levels.choosing altrient b is the perfect solution. this unique liposomal vitamin complex is capable of delivering a much higher absorption rate than other products on the market. altrient b uses ingenious let technology to encapsulate the nutrients inside tiny phospholipid bubbles that by-pass the digestive system, transporting the contents directly to the cells that need them - allowing for almost 100% bioavailability.vital for maintaining energy and metabolic function.contributes to healthy hair, nails and skin.supports optimum memory and brain function.contributes to healthy cell renewal and function of the nervous system.enhances glucose metabolism and helps regulate insulin sensitivity.nature cleverly combines nutrients in food that work together very effectively to provide a multitude of health benefits. as an example, broccoli provides vitamin c, alpha lipoic acid, b vitamins and a whole range of other beneficial compounds. these combined nutrients have a far greater effect on health than an individual nutrient working alone.combining supplements in a similar way ensures that the co-factors needed to stimulate activity of specific nutrients such as vitamin c are available to maximise its effects in the body. with this in mind, we have carefully paired nutrients that have a powerful synergy so we can offer you the perfect combinations for sparkling good health. nutritional facts altrient b nutritional facts: 1 sachet (6ml) 30 sachet's per box amount per serving% nrv   vitamin b1 (as thiamine hcl)100 mg9,091%vitamin b2 (as riboflavin)8.5 mg607%niacin (as niacinamide)20 mg125%pantothenic acid (as d-calcium pantothenate)10 mg167%vitamin b6 (as pyridoxine hci)10 mg714%folate ([6s]-5-methyltetrahydrofolic acid, as 200μg quatrefolic® [6s]-5-methyltetrahydrofolic acid,glucosamine salt)100 μg50%vitamin b12(as methylcobalamin and cyanocobalamin)50 μg2,000%biotin (as d-biotin)300 μg600%mineralszinc (as zinc glycinate)20 mg200%selenium (as selenomethionine)50 μg91%chromium (as chromium picolinate)50 μg125%other ingredientscinnamon (cinnamomum cassia) bark extract25 mg†phospholipids (from soy lecithin)500mg†of which phosphatidylcholine250 mg†* recommended daily allowance  †rda not established dosage as a dietary supplement take 1-2 sachets per day.higher therapeutic doses may be necessary, take advice from your doctor or health practitioner.if you are pregnant or breastfeeding, consult a healthcare practitioner before using this product.for best results, snip or tear the notched end off the sachet, squeeze the gel contents into a small amount of water or your favourite cool beverage and shot it down quickly.to speed up absorption drink on an empty stomach, and wait at least 15 minutes before eating.if you are prone to low blood sugar levels, it is best to take the altrient b just before a light meal. hypoglycemic substances like caffeine should be avoided for at least 15 minutes after taking the product. storage store in a cool, dry place, can be refrigerated.do not freeze or place the product in direct sunlight for extended periods of time.https://redsupps.co.uk/products/altrient-b-liposomal-vitamin-bhttps://cdn.shopify.com/s/files/1/2544/1734/products/altrient-b-liposomal-vitamin-b-complex_600x600_crop_center.jpg?v=1543507215Livon new 710941540403in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsVITAMIN B 54.99GBP shopify_710835404851_8488840101939Altrient c liposomal vitamin c  descriptionmost ordinary forms of oral vitamin c – tablets, capsules, powders, liquids and even dietary sources are not metabolised efficiently due to tightly regulated absorption controls in the body. this means that levels of vitamin c in the intestines reaches saturation point at as little as 200mg. in fact, the more we take in the less we absorb. thus, very little reaches your blood stream let alone the cells where it is needed most. until recently intravenous delivery of vitamin c has proven to be the most effective route for absorption, but this method is both costly and impractical.altrient c offers the perfect solution because of its scientifically proven liposomal delivery method. this powerful form of transportation encapsulates the nutrient in a microscopic phospholipid bubble that carries it within minutes directly to the cells, protecting it from the destructive elements of the digestive system. altrient c is the most effective option for ensuring your body has adequate vitamin c levels.helps maintain normal function of the immune system, promoting overall good health.supports collagen formation for healthy joints, bones, skin, gums, cartilage and blood vessels.supports normal functioning of the nervous system, helping the body to cope with stress.contributes to the reduction of tiredness and fatigue, helping to maintain normal energy levels.helps to protect cells from oxidative stress, plays a key role in wound healing & tissue repair.an independent double-blind, placebo controlled study carried out by princeton consumer research centre, proved a staggering 61.4% increase in skin firmness and elasticity and a reduction in the appearance of fine lines and wrinkles on both the face and body. those given placebo treatment showed no change at all.these incredible results were achieved by taking just 3 sachets of altrient c a day over a 16 week period. at week 8 elasticity had increased by 40%, by week 12 it had reached 60.8% and by week 16 it had risen to 61.4%. of the 41 women that took part ranging from 31 to 61 years old, all said that they would add altrient c to their daily skincare routine."this nutrient boosts collagen production, cleverly protects skin cells from the harmful effects of uv light and assists with skin cell repair and renewal."- susie perry debice, health writer, author and nutritionist  nutritional facts altrient c nutritional facts: 1 sachet (5.7ml) 30 sachet's per boxamount per sachet  % rda*vitamin c (as sodium ascorbate, corn derived)1,000 mg1,250%phospholipids (soy derived)1,000 mg†of which phosphatidylcholine500 mg†* recommended daily allowance  †rda not establishedingredients: deionized water, sodium ascorbate (corn derived), lecithin phospholipids (soy derived), alcohol (ethanol 12% w/w), xanthan gum, citric acid (for ph adjustment).free from: gmo ingredients, sugar, wheat, gluten, yeast, dairy, meat products, hexane, soy protein, artificial colours and flavours. non-acidic and gentle on the stomach. dosage as a dietary supplement take 1-2 sachets per day.higher therapeutic doses may be necessary, take advice from your doctor or health practitioner.if you are pregnant or breastfeeding, consult a healthcare practitioner before using this product.for best results, snip or tear the notched end off the sachet, squeeze the gel contents into a small amount of water or your favourite cool beverage and shot it down quickly.to speed up absorption drink on an empty stomach, and wait at least 15 minutes before eating. storage store in a cool, dry place, can be refrigerated.do not freeze or place the product in direct sunlight for extended periods of time.https://redsupps.co.uk/products/altrient-c-liposomal-vitamin-chttps://cdn.shopify.com/s/files/1/2544/1734/products/altrient-c-liposomal-vitamin-c-by-livon-labs_600x600_crop_center.jpg?v=1543507218Livon new 710835404851in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsVitamin C 39.00GBP shopify_710982926387_8489124266035Altrient gsh liposomal glutathione descriptionmost ordinary forms of glutathione – tablets, capsules, powders, liquids and even dietary sources are of little benefit as they are unable to withstand the digestive processes in the body and absorption levels are poor. until recently intravenous delivery of glutathione has proven to be the most effective route for absorption, but this method is both costly and impractical. fortunately, altrient glutathione uses a clinically proven liposomal glutathione called setria offering significant advantages….setria glutathione is the purest and safest form of glutathione, produced using a patented fermentation process. altrient glutathione is encapsulated within layers of essential phospholipids called liposomes. these form a protective membrane around the contents, allowing almost 100% bio-availability. the tiny liposomal bubbles can by-pass the digestive juices and deliver the glutathione straight to the cells. this oral formula offers a simple and efficient way to increase the body’s levels of glutathione without the inconvenience and cost of intravenous administration.supports liver detoxification and regeneration.helps protect cells from oxidative stress & free radical damage.helps defend against viruses and bacteria, plays a key role in the body's immune responses.helps maintain normal brain function.enhances activation of vitamins e and c for maximum healing power.nature cleverly combines nutrients in food that work together very effectively to provide a multitude of health benefits. as an example, broccoli provides vitamin c, alpha lipoic acid, b vitamins and a whole range of other beneficial compounds. these combined nutrients have a far greater effect on health than an individual nutrient working alone.combining supplements in a similar way ensures that the co-factors needed to stimulate activity of specific nutrients such as vitamin c are available to maximise its effects in the body. with this in mind, we have carefully paired nutrients that have a powerful synergy so we can offer you the perfect combinations for sparkling good health. nutritional facts altrient glutathione nutritional facts: 1 sachet (5.4ml) 30 sachet's per boxamount per sachet  % rda*l-gutathione (reduced form)450 mg†phospholipids (soy derived)1,000 mg†of which phosphatidylcholine500 mg†* recommended daily allowance  †rda not establishedingredients: deionized water, l-glutathione, lecithin phospholipids (soy derived), alcohol (ethanol 12% w/w), xanthan gum.free from: gmo ingredients, sugar, wheat, gluten, yeast, dairy, meat products, hexane, soy protein, artificial colours and flavours. non-acidic and gentle on the stomach. dosage as a dietary supplement take 1-2 sachets per day.higher therapeutic doses may be necessary, take advice from your doctor or health practitioner.if you are pregnant or breastfeeding, consult a healthcare practitioner before using this product.for best results, snip or tear the notched end off the sachet, squeeze the gel contents into a small amount of water or your favourite cool beverage and shot it down quickly.to speed up absorption drink on an empty stomach, and wait at least 15 minutes before eating. storage store in a cool, dry place, can be refrigerated.do not freeze or place the product in direct sunlight for extended periods of time.https://redsupps.co.uk/products/altrient-gsh-liposomal-glutathionehttps://cdn.shopify.com/s/files/1/2544/1734/products/altrient-gsh-liposomal-glutathione-livon-labs_600x600_crop_center.jpg?v=1543507223Livon new 710982926387out of stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIPOSOMAL GLUTATHIONE 79.00GBP shopify_711023427635_8489286369331Altrient r-ala liposomal r-alpha lipoic acid  descriptionmost ordinary forms of alpha lipoic acid – tablets, capsules, powders and liquids come in the chemically synthesised form of s-lipoic acid (s-la) which is stable and cheap to produce but it’s benefits are limited. altrient uses the form naturally occurring in plants called r-lipoic acid (r-la) which has exceptional health benefits due to its unique fat and water soluble properties.these allow it to work inside and outside of the cells, protecting virtually all body tissues against free radical damage. whilst r-la is proven to be far better absorbed than s-la it is highly unstable and rapidly excreted. fortunately, altrient r-ala has the answer providing a superior form of r-la without compromising on stability. it achieves this by encapsulating r-la into a cleverly designed phospholipid bubble called a liposome. this powerful delivery system manages to withstand all digestive challenges transporting the ala directly into the cells where it’s needed most.enhances cellular protection, playing a vital role in regenerating other antioxidants.helps regulate insulin sensitivity and reduce the effects of diabetic neuropathy.supports liver repair and heavy metal detox.contributes to healthy cardiovascular and reproductive function.supports mitochondrial function helping to reduce excess weight.nature cleverly combines nutrients in food that work together very effectively to provide a multitude of health benefits. as an example, broccoli provides vitamin c, alpha lipoic acid, b vitamins and a whole range of other beneficial compounds. these combined nutrients have a far greater effect on health than an individual nutrient working alone.combining supplements in a similar way ensures that the co-factors needed to stimulate activity of specific nutrients such as vitamin c are available to maximise its effects in the body. with this in mind, we have carefully paired nutrients that have a powerful synergy so we can offer you the perfect combinations for sparkling good health. nutritional facts altrient r-ala nutritional facts: 1 sachet (5.7ml) 30 sachet's per boxamount per sachet  % rda*r-alpha lipoic acid226mg†phospholipids (soy derived)1,000 mg†of which phosphatidylcholine500 mg†* recommended daily allowance  †rda not establishedingredients: deionized water, lecithin phospholipids (soy derived), alcohol (ethanol 12% w/w), adenosiine monophosphate, (natural flavour modifier), r-alpha lipoic acid, natural lemon flavouring, xanthan gum.free from: gmo ingredients, sugar, wheat, gluten, yeast, dairy, meat products, hexane, soy protein, artificial colours and flavours. non-acidic and gentle on the stomach. dosage as a dietary supplement take 1-2 sachets per day.higher therapeutic doses may be necessary, take advice from your doctor or health practitioner.if you are pregnant or breastfeeding, consult a healthcare practitioner before using this product.for best results, snip or tear the notched end off the sachet, squeeze the gel contents into a small amount of water or your favourite cool beverage and shot it down quickly.to speed up absorption drink on an empty stomach, and wait at least 15 minutes before eating. storagestore in a cool, dry place, can be refrigerated.do not freeze or place the product in direct sunlight for extended periods of time.https://redsupps.co.uk/products/altrient-r-ala-liposomal-r-alpha-lipoic-acidhttps://cdn.shopify.com/s/files/1/2544/1734/products/altrient-liposomal-r-alpha-lipoic-acid-livon-labs_600x600_crop_center.jpg?v=1543507228Livon new 711023427635out of stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIPOSOMAL R-ALPHA LIPOIC ACID 79.00GBP shopify_1488897867827_13401560907827Amp-v descriptionamp-v is a combination of essential fatty acids and omegas such as 3,5,6,7,9 all of which are vegan friendly! it packs a helpful hit of peppermint to assist with central nervous system stimulation without any stimulants, so you get the improved cognitive function and nervous system processes without the crash associated with caffeine-based products. amp-v also aids in the release of fatty acids from your stored fat. thus, it is advisable to take amp-v first thing in the morning before you hit the gym, hit the road for a run or walk or take on any physical challenge you wish!amp-vamp-v is a revolutionary patent pending formula which is formulated to help you burn fat more effectively when you exercise and as an appetite suppressant between meals. the net result is greater fat loss and improved energy. amp-v is also an excellent source of omega 3,5,6,7 and 9 essential fatty acids.specially, amp-v aids in the release of fatty acids from your stored fat. thus, it is advisable to take amp-v first thing in the morning before you hit the gym, hit the road for a run or walk or take on any physical challenge you wish! after an 8-hour sleep, you haven’t eaten for hours and you are usually burning some fat for fuel, this is our best opportunity to stimulate fat burning if you exercise first thing in the morning. when used with an effective diet and exercise strategy amp-v helps you access your stored fat so you can achieve your fat loss goals faster and easier.amp-v achieves this by the unique array of nutrients in the formula. these include:conjugated linoleic acid (cla)assists in the release of fatty acids from stored fat cells and the burning of fatty acids in the mitochondria. cla interacts synergistically with the grapefruit oil to activate ppar increasing the gene transcription related to lipolysis (fat breakdown), mitochondrial biogenesis and insulin sensitivity, and collectively this enhances the release of free fatty acids and subsequent mitochondrial activation to burn the fatty acids.pomegranate seed oilaids in the reduction of blood sugar levels, the burning of fat by increasing carnitine levels and upregulating fatty acid burning genes. pomegranate seed oil can increase carbohydrate oxidative capacity and it prevents diet-induced obesity and reduces insulin resistance.peppermint oilpeppermint oil is a central nervous system stimulant and can induce lipolysis to liberate fats during exercise by a very novel mechanism via activation of trpm8 thermoregulatory receptors. even when you are not exposed to cold or feeling cold, menthol produces an increase in oxygen consumption and enhances non-shivering thermogenesis and lipolysis. basically, menthol can trick your nerves into thinking you are cold and your body responds by increasing heat production from fat. peppermint oil enhances lipolysis, thermogenesis and fatty acid oxidation. peppermint oil has demonstrated performance enhancing effects with a significant increase in the grip force (36.1%), standing vertical jump (7.0%), and standing long jump (6.4%).peppermint oil also tastes great.grapefruit essential oilgrapefruit essential oil enhances lipolysis and fatty acid oxidation by modulating the “ppar” group of receptors to improve fatty acid release, improve insulin sensitivity and prevent against spikes in insulin and blood glucose that switch off fat burning. furthermore, grapefruit oil increases the activity of genes in fat cells which are closely related to fatty acid synthesis and oxidation. grapefruit essential oil directly interacts with the central nervous system, exciting nerves to induce fat burning and energetic arousal.medium-chain triglycerides (coconut oil) medium-chain triglycerides (mcts) bypass the block in long-chain fatty acid oxidation and provide an alternative faster energy substrate to exercising muscle. mct are known to hydrolyse readily and completely to fatty acids and to be metabolized more easily by beta-oxidation than long-chain triglycerides. mct differ from long-chain triglycerides as they are relatively soluble in water and hence rapidly hydrolysed into energy.once you get to work or get on with your day, amp-v can also be used to suppress those cravings and help you resist that cake someone always brings into work.how to best use amp-v for either stripping fat, bulking up or toning up. stripping fatfor fat loss when combined with calorie deficit and depletion of glycogen and atp the amp-v works via modulation of the ppar receptors with essential fatty acids and enhancing ampk activation. post workout stay depleted and you burn for longer.bulking upfor muscle hypertrophy use amp-v as a pre-workout and maintain adequate or a surplus of nutrition and calories in the form of protein and carbohydrates than you will get the performance enhancing effects, the mental clarity, the ppar modulation but not the ampk activation that inhibits mtor pathways for protein synthesis. post workout load up and stimulate growth.toning upthe middle ground which is best for a bit of each involves using the amp-v for fasted exercise and then replenishing after exercise to stimulate protein synthesis and recovery. keep you with a bit of each. most people will find this works for them. the athletes that run on bulking and cutting campaigns that need to create extreme change will do the more strategic cycles.there are no fillers, no sweeteners, no artificial flavours, no wasted space. every drop is active.100% active ingredients, no fillers, no sweeteners, no artificial flavours, no wasted space. every drop is active.amp-v has the following properties:enhances thermogenesis.improves strength.enhances oxygenation.improves endurance.directions for usefasted cardio – drink 2ml pre-workout on an empty stomach, may use again intra-workout.keto / low carb / high fat /high protein diets – drink 2ml pre-workout, may use again throughout the day as an appetite suppressant and energy tonicpre-workout – drink 2ml pre-workout, may use again intra-workoutpre-meal – drink 2 ml immediately before meal or add to salad dressing / vinaigrette to curb your hungerwe recommend no more than 6 serves per dayhttps://redsupps.co.uk/products/amp-vhttps://cdn.shopify.com/s/files/1/2544/1734/products/AMPV-1_600x600_crop_center.jpg?v=1543507238ATP Science new 1488897867827in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 39.99GBP shopify_1638329909299_15892092125235Andar1ne the key benefits of s4 (andarine)s-4 is by far the most versatile sarm ever created. not only is it the first sarm approved for a stage 2 research study, it has become the most analyzed and investigated sarm so far. after the discovery of its anabolic potential, the primary purpose of s-4 aimed to develop an alternative treatment to age-related muscle wasting, osteoporosis, and similar symptoms of hypogonadism, or end-stage renal disease.aside from preserving lean body mass, s4 can also help improve it.from a stage 1 study, s-4 has provided evidence of a 3.3 lbs increase in less than 90 days with no increases exercise or change in daily diet. an unintended side effect (or benefit if you will) is the decrease in body fat [chen et al., 2005; gao et al., 2005; kearbey et al., 2007]. decreases in body fat are dependent on the person’s genetics, but it will definitely have strong effects on the body’s ability to oxidize fatty tissue. s-4 was found to not only have a great affinity (potency in binding to androgen receptors), while also presenting greater anabolic effects than some traditional steroids [kearbey et al., 2007].aside from its muscle building advantages, s4 won’t cause liver damage, can prevent gynecomastia (enlarged breasts in men) and can help boost your overall health.here are some of the other benefits of andarine that are worth noting:very minimal growth on secondary sexual organs such as the prostate.the ldl/ hdl ratio is not affected which makes it a low cardiovascular risk.0% chance of aromatization, male breast lactation, or rise in any other female characteristic during the post cycle recovery. [kearbey et al., 2007]testosterone is not diminished in any capacity during the post cycle recovery.very exclusive in tissue selection and growth which means it will not cause heart enlargement or damage to neighboring organs.sarms do not require the utilization or devouring of liver enzymes to activate their anabolic effects. this eliminates any risk of hepatotoxicity or hepatitis.although sarms such as s-4 are not as powerful as comparable steroids such as winstrol, they do not require the extensive post cycle therapy and can be cycled back to back throughout the year. over the course of a year, obtaining the same results is very possible.sarms is very female friendly and does not cause excessive masculine features such enlarged sexual characteristics.s-4 has overall presented larger increases in muscle mass than dht.full muscle regeneration & lean body massonce more, an early study done on s-4 provided proof of full muscle regeneration in volunteers with degenerative disorders without the use of exercise and the minimum dosage of 3mg/kg/day. changes can be seen anywhere from 1-2 weeks. this was the very first study classified s-4 as clinically significant by improving skeletal muscle strength, lean body mass, and a reduction in body fat [chen et al., 2005; gao et al., 2005; kearbey et al., 2007]. unfortunately, there are always some side effects that arise when using because s-4 is a ligand by definition, the side effects will never be permanent even at supraphysiological dosages and can be easily avoided through proper dosing.the side effects: what you “see” is what you getunfortunately, there are always some side effects that arise when using because s-4 is a ligand by definition, the side effects will never be permanent even at supraphysiological dosages and can be easily avoided through proper dosing. also, andarine follows the law of diminishing returns meaning that over time, your body will develop a tolerance and the sarm will become less effective after a certain milligram percentage. for the average person it ranges from 50mg to 75mg. there are people that can go above this range for even more amazing results or need to stay below this range because they are unable to tolerate the chemical. about 99.5% of the population should fall within the 50mg to 75mg range.the most popular negative effects of s-4 are visual issues such as the yellow tint and difficulty adjusting to night vision. these side effects are unique to s-4 and are sometimes overblown. if these side effects present themselves, simply stop taking s-4 for two days and stay at a 5 day on/ 2 day off cycle. these effects are not permanent! once a ligand (such as a sarm) leaves the system, it’s effects disappear completely.lastly, s-4 and most other sarms have been known to cause depression in a small population of people. this has been discovered as more of a psychological issue than a physiological issue. researchers with mice suffering from any emotional disorders need to be cautious when using this chemical.dosing guidelinesbenefits of andarine have been reported with dosages ranging between 25mg and 50mg 3x per day.unfortunately, the higher the dosage, the higher the side effects. s4 is a rare form of sarm that has a greater risk of side effects than most other sarms.these effects are not permanent. s4 has been proven safe and effective for cycles up to 3 months.results may vary from person to personthese statements have not been evaluated by the food and drug administration. this product is not intended to diagnose, treat, cure, or prevent any disease.we make no ‘therapeutic claims’. therapeutic goods are broadly defined by the tga as products for use in humans in connection with:• preventing, diagnosing, curing or alleviating a disease, ailment, defect or injury• influencing inhibiting or modifying a physiological process• testing the susceptibility of persons to a disease or ailment• influencing, controlling or preventing conception• testing for pregnancyhttps://redsupps.co.uk/products/andar1nehttps://cdn.shopify.com/s/files/1/2544/1734/products/Andar1ne-clear-copy_600x600_crop_center.png?v=1544866188Olympus Labs new 1638329909299in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsSARM 52.99GBP shopify_369641750565_4714184278053Anesthetized key featuresknocks you out fast!allows for muscle recovery descriptionmaking gains isn’t purely about lifting big and eating big, it’s also about sleeping big too! far too often athletes train their tails off but don’t get enough sleep at night, and shortcut their growth potential, thereby limiting their results.  directionsas a dietary supplement, take one (1) scoop in 8-12 oz. of water 30 minutes prior to bed tie. due to extreme potency, user may wish to begin by consuming one half (1/2) scoop to assess tolerance.https://redsupps.co.uk/products/blackstone-labs-anesthetized-25-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/anesthetized-pineapple_600x600_crop_center.png?v=1544113287Blackstone Labs new 369641750565in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsSleep Aid 35.99GBP shopify_1564330557491_15379130974259Animal cuts Animal cutsor bodybuilders, all the muscle in the world means little if it is shrouded by layers of bodyfat. there comes a time when what has been built and hard-earned through the heaviest weights and most intense training sessions, must be displayed to the world. there’s going to be some strict dieting on the horizon, some serious cardio in your future. but it might take something extra to deliver that grainy, striated look of etched musculature. that’s when you add animal cuts.more competitive bodybuilders whose careers depend on razor-sharp definition have turned to animal cuts than any other. the animal cuts formula is comprehensive. think of it as everything you need, conveniently dosed in a single pack. you don't have to think about anything. just pop a 'pack' twice a day for three weeks and you’re set.cuts is complete from top to bottom. animal cuts targets many aspects of the cutting process. it includes eight complexes: (1) thermogenic complex; (2) metabolic complex; (3) thyroid complex; (4) diuretic complex; (5) nootropic complex; (6) cortisol-inhibiting complex; (7) appetite suppression complex; and (8) our special bioavailability complex.as a thermogenic, animal cuts is extremely powerful. thermogenesis is the 'burning' of calories from stored body fat. this in turn increases body temperature and provide a source of utilizable energy to the body. animal cuts includes potent thermogenics that can help boost the body’s natural ability to burn stored body fat while sparing lean mass (muscle), the body’s own fat-burning furnace.from a metabolic point of view, animal cuts, is stacked with only the most potent compounds. from green tea extract to oolong tea extract to white tea extract to black tea extract, it’s all covered here. a faster metabolism equates to more efficient fat burning and fewer calories being stored as bodyfat. compounds designed to elevate metabolism then can mean the difference between success and failure.when it comes to shedding excess water weight stored under the skin (the kind that gives you that "soft" look), animal cuts is extremely efficient. the problem with most diuretics is that they often deplete the body of key electrolytes, including potassium. when this happens, your muscles lose their pump and size. unlike other products, animal cuts also contains potassium-sparing herbs which help preserve muscular fullness. dieting is stressful. dieting can cause the release of the 'stress' hormone cortisol. high levels of cortisol can wreak havoc on natural hormone production and actually eat away at lean muscles. this is precisely the opposite of what bodybuilders want, especially when the body is already in a depleted state from reduced caloric intake. animal cuts has a unique cortisol-inhibiting complex (including patented serinaid) that is designed to help blunt cortisol production, allowing your body to stay in a more positive anabolic environment.finally, three additional components round out animal cuts' potent formula. the first of these is a nootropic complex which contains important brain 'boosting' ingredients designed to help maintain proper brain chemistry and also allow for better focus and increased alertness during the workout. another benefit of nootropics is increased oxygen supply to the brain and the increase of neurotransmitter output and neuromuscular performance.the second of animal cut’s final components are cck boosters (appetite 'suppressants'). animal cuts contains natural ingredients to help reduce sugar and carb cravings. if you are a bodybuilder, then you know how powerful these cravings can be, especially during prep time. so it goes without saying that it’s far easier to keep a diet clean when the 'munchies' are held at bay.finally, we've included compounds designed to deliver the active ingredients (including patented bioperine) in animal cuts more effectively. this is the bioavailability complex. natural compounds like gingerols, shogaols, 6,7-dihydroxybergamottin, naringin, quercetin and the like are used for this purpose.there's no sense wasting a single milligram of the actives found in animal cuts. each conveniently dosed 'pack' of animal cuts delivers nearly 8,500 milligrams of pure, active shredding power. with a proper diet, exercise, and animal cuts, your cutting goal will be reached faster than ever before. whether for a competition on stage, or simply for the competition with yourself—the most important of all, animal cuts has got your back.https://redsupps.co.uk/products/animal-cutshttps://cdn.shopify.com/s/files/1/2544/1734/products/animal_cuts_600x600_crop_center.jpg?v=1543507245Universal Nutrition new 1564330557491in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsComplete Cutting Stack 35.99GBP shopify_1564318138419_15378980077619Animal energy animal energywhether you’re training 1-2 hours and need to be at your peak or just need a pick-me-up on off days to get things done, you may need a lift every now and then. for those times when you need clean energy, enhanced focus and mood without a crash, check out animal energy. with its convenient 1-capsule dose, animal energy is simple to use yet powerful. animal energy’s unique 2-stage delivery system provides both quick and lasting effects. our product can help you when you need to be strong and help push you through days that feel long.https://redsupps.co.uk/products/animal-energyhttps://cdn.shopify.com/s/files/1/2544/1734/products/animal-energy_2000x_8dac1158-c0b8-4863-b5a7-277265d5d217_600x600_crop_center.jpg?v=1543507248Universal Nutrition new 1564318138419in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsEnergy Pills 8.99GBP shopify_1564335308851_15379176620083Animal flex Animal flexserious trainers take a beating in the gym. this iron sport is grueling, arduous and repetitive. there’s no way around that reality. you will be sore, you will get hurt, you will feel pain regularly. how you recover, how you respond how you remedy and deal with that pain will ultimately determine how strong you are on the platform or high you ascend on the competitive bodybuilding stage.to reach the lofty goals you set for yourself, think marathon and not sprint. you have to approach training like it’s your job. if you’re out sick, you’re not moving forward. the same applies in the gym. if you’re injured, you can’t train. and if you can’t train, you won’t grow. nagging injuries and joint issues will most certainly hinder a lifter’s progress. dealing with injuries is all part of the game, and some are simply beyond your control. but there are measures you can take to fortify your weak links and minimize the nicks and dings that come with the territory when training on a high level. one such preventative step is joint support nutrition.no other joint supplement designed for serious lifters has won more awards and accolades than animal flex. why? because animal flex flat out works. animal flex has won the prestigious 'joint supplement of the year' award eight years in a row. but more importantly, animal flex has changed the lives of lifters around the world and has helped keep them in the gym, day in and day out.when you’re building a house, you need to make sure that its foundation is rock solid, because that massive structure puts tremendous pressure on the underlying base. as an athlete, you should focus as much attention on the foundation as on the structure that sits atop it. your body’s foundation is your joints, ligaments, tendons, and all the connective tissue the framework that supports your growing muscle. the harder you train, the more stress you put on your structure. each workout not only taxes muscle but sinew and can, over time, weaken this vital connective tissue. remember, when a foundation crumbles, the house is quick to follow and the bigger the house, the bigger that potential.animal flex works by helping to strengthen joints and ligaments, shielding them from the daily wear and tear brought about rigorous training. the ingredients in animal flex can help maintain healthy joint function, elasticity, and flexibility. many of animal flex’s active ingredients provide the basic building blocks that are required to maintain human structural integrity.animal flex, like other animal supplements, is complete and comprehensive. each pack of animal flex consists of several key protective complexes: (1) a potent joint construction complex to help repair connective tissue; (2) a lubrication compound to help cushion the joints from lifting; (3) a support complex to help promote rehabilitation and reduce soreness; and (4) an essential vitamin/mineral blend to underscore optimal joint health.as a joint 'constructor', animal flex is powered by proven reconstruction nutrients. animal flex provides the joints with the essential raw materials such as glucosamine (two forms), msm, and chondroitin… ingredients designed to naturally protect and restore joint health while strengthening the underlying cartilage and connective tissue. these nutrients, once absorbed, can work quickly and efficiently to aid in the rebuilding of cartilage.from a joint lubrication point of view, hyaluronic acid (ha), patented cetyl myristoleate (cmo), and flax seed oil provide the “lubricant” needed to coat your joints and protect them from the constant grind of training excess and resulting stiffness. these potent joint lubricators naturally restore the oils present in the synovial fluid to make joints work smoothly and painlessly. when it comes to joint support, animal flex utilizes potent natural herbal extracts to help address the free radical load—a consequence of inflammation of the joints. herbs and extracts like turmeric, boswellia and ginger root have been shown to help inhibit pro-inflammatory metabolites, which leads to a strong and prolonged anti-inflammatory effect. a reduction in inflammation is critical for maintaining pain free joints and for protection against degenerative joint issues often related to years of heavy lifting. unlike pain relievers that only mask the symptoms, the compounds in animal flex offer real support and promotes long term joint health. animal flex also incorporates a specialized vitamin and mineral blend. this blend is added to provide maximum nutritional support. this key vitamin mix provides you with the basic essential micro-nutrients needed for joint health. nutrients such as vitamins c, e, zinc, selenium and manganese are needed for to support healthy joints. these nutrients provide the backbone for proper joint health.here’s the kicker. unlike other joint formulas, you won't need to take animal flex three times a day. despite its potency and comprehensive nature, you just take a single dose (or packet) of animal flex daily. that’s it. how easy is that? best of all, like all animal products (including animal pak, animal cuts, animal test and the like), animal flex comes with an “ironclad” product guarantee. so there really is no reason not to give animal flex a try.dedicated lifters ourselves, we formulated animal flex to address the sorts of inevitable joint wear and tear issues we faced daily. progress is always our purpose. and that progress is predicated on consistent daily effort in the gym. for those who understand this commitment to the iron, and who can’t afford to be sidelined by joint issues, we created animal flex.https://redsupps.co.uk/products/animal-flexhttps://cdn.shopify.com/s/files/1/2544/1734/products/Animal_Flex_i2377_d1200x1200_600x600_crop_center.png?v=1543507261Universal Nutrition new 1564335308851in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsComplete Joint Support Stack 27.99GBP shopify_1564365848627_15379632128051Animal flex powder animal flex powderserious trainers take a beating in the gym. this iron sport is grueling, arduous and repetitive. there’s no way around that reality. you will be sore, you will get hurt, you will feel pain regularly. how you recover, how you respond how you remedy and deal with that pain will ultimately determine how strong you are on the platform or high you ascend on the competitive bodybuilding stage.to reach the lofty goals you set for yourself, think marathon and not sprint. you have to approach training like it’s your job. if you’re out sick, you’re not moving forward. the same applies in the gym. if you’re injured, you can’t train. and if you can’t train, you won’t grow. nagging injuries and joint issues will most certainly hinder a lifter’s progress. dealing with injuries is all part of the game, and some are simply beyond your control. but there are measures you can take to fortify your weak links and minimize the nicks and dings that come with the territory when training on a high level. one such preventative step is joint support nutrition.no other joint supplement designed for serious lifters has won more awards and accolades than animal flex. why? because animal flex flat out works. animal flex has won the prestigious 'joint supplement of the year' award eight years in a row. but more importantly, animal flex has changed the lives of lifters around the world and has helped keep them in the gym, day in and day out.when you’re building a house, you need to make sure that its foundation is rock solid, because that massive structure puts tremendous pressure on the underlying base. as an athlete, you should focus as much attention on the foundation as on the structure that sits atop it. your body’s foundation is your joints, ligaments, tendons, and all the connective tissue the framework that supports your growing muscle. the harder you train, the more stress you put on your structure. each workout not only taxes muscle but sinew and can, over time, weaken this vital connective tissue. remember, when a foundation crumbles, the house is quick to follow and the bigger the house, the bigger that potential.animal flex works by helping to strengthen joints and ligaments, shielding them from the daily wear and tear brought about rigorous training. the ingredients in animal flex can help maintain healthy joint function, elasticity, and flexibility. many of animal flex’s active ingredients provide the basic building blocks that are required to maintain human structural integrity.animal flex, like other animal supplements, is complete and comprehensive. each pack of animal flex consists of several key protective complexes: (1) a potent joint construction complex to help repair connective tissue; (2) a lubrication compound to help cushion the joints from lifting; (3) a support complex to help promote rehabilitation and reduce soreness; and (4) an essential vitamin/mineral blend to underscore optimal joint health.as a joint 'constructor', animal flex is powered by proven reconstruction nutrients. animal flex provides the joints with the essential raw materials such as glucosamine (two forms), msm, and chondroitin… ingredients designed to naturally protect and restore joint health while strengthening the underlying cartilage and connective tissue. these nutrients, once absorbed, can work quickly and efficiently to aid in the rebuilding of cartilage.from a joint lubrication point of view, hyaluronic acid (ha), patented cetyl myristoleate (cmo), and flax seed oil provide the “lubricant” needed to coat your joints and protect them from the constant grind of training excess and resulting stiffness. these potent joint lubricators naturally restore the oils present in the synovial fluid to make joints work smoothly and painlessly. when it comes to joint support, animal flex utilizes potent natural herbal extracts to help address the free radical load—a consequence of inflammation of the joints. herbs and extracts like turmeric, boswellia and ginger root have been shown to help inhibit pro-inflammatory metabolites, which leads to a strong and prolonged anti-inflammatory effect. a reduction in inflammation is critical for maintaining pain free joints and for protection against degenerative joint issues often related to years of heavy lifting. unlike pain relievers that only mask the symptoms, the compounds in animal flex offer real support and promotes long term joint health. animal flex also incorporates a specialized vitamin and mineral blend. this blend is added to provide maximum nutritional support. this key vitamin mix provides you with the basic essential micro-nutrients needed for joint health. nutrients such as vitamins c, e, zinc, selenium and manganese are needed for to support healthy joints. these nutrients provide the backbone for proper joint health.here’s the kicker. unlike other joint formulas, you won't need to take animal flex three times a day. despite its potency and comprehensive nature, you just take a single dose (or packet) of animal flex daily. that’s it. how easy is that? best of all, like all animal products (including animal pak, animal cuts, animal test and the like), animal flex comes with an “ironclad” product guarantee. so there really is no reason not to give animal flex a try.dedicated lifters ourselves, we formulated animal flex to address the sorts of inevitable joint wear and tear issues we faced daily. progress is always our purpose. and that progress is predicated on consistent daily effort in the gym. for those who understand this commitment to the iron, and who can’t afford to be sidelined by joint issues, we created animal flex.https://redsupps.co.uk/products/animal-flex-powderhttps://cdn.shopify.com/s/files/1/2544/1734/products/animal_flexx_600x600_crop_center.jpg?v=1543507263Universal Nutrition new 1564365848627in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsComplete Joint Support Stack 23.99GBP shopify_1564346384435_15379382173747Animal fury Animal furybring the pain. the further you advance in this lifestyle, you start to realize what is truly necessary. to grow bigger and stronger consistently, you have to be willing to go to lengths others wouldn’t dare. to stimulate new growth and transcend your physical limitations you have to push through on the heaviest and hardest sets, and learn to embrace the pain. you learn to love the pain of your muscles straining and burning, because you’ve come to understand, that is how you grow. to bring about new development, you must grow comfortable with being uncomfortable… you’ve gotta embrace the pain.when we formulated animal fury, we had that rare mindset in mind. we set out to design a no-nonsense pre-workout powder keg that could help serious lifters stay locked in “the zone”. combining proven pre-training staples like citrulline malate, beta alanine, l-tyrosine and caffeine anhydrous all in efficacious doses with a whopping five grams of branched-chain amino acids (bcaa), every scoop of animal fury packs one hell of a muscle-building punch. performance. focus. energy. that hits hard. no bullshit. and utilizing no proprietary blends, you can rest assured that you know exactly what you’re getting in each loaded shaker cup of fury.impossible as it might seem, fury tastes as good as it works. in crisp and refreshing green apple and watermelon flavors, animal fury also pops with tantalizing taste. flavorful and bright, drinking animal fury is an enjoyable ritual you will look forward to with eager anticipation, coming to life and gaining sharper focus with each delicious sip. being in this game for so long, we never imagined dominating the iron could taste so damn good. animal fury made that reality.constant progress. that’s the bottom line. it isn’t a ballgame or a birthday party... it isn’t always fun. it is the beautiful and belligerent process that can make monsters out of mere mortal men and forge freaks from the flock. it takes time, discipline, consistency and a fair amount of pain, because growth of any consequence hurts. but the agony of great effort is a price worth paying for the glory of victory. it is with an understanding of the unyielding commitment of champions that we built animal fury, one potent ingredient at a time. so that when the weights challenge you, you can rise to the occasion, resolute and unafraid... prepared to dig deep... ready to bring the pain.https://redsupps.co.uk/products/animal-furyhttps://cdn.shopify.com/s/files/1/2544/1734/products/animal_fury_600x600_crop_center.jpg?v=1543507265Universal Nutrition new 1564346384435in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 27.99GBP shopify_1564346384435_15379382206515Animal fury Animal furybring the pain. the further you advance in this lifestyle, you start to realize what is truly necessary. to grow bigger and stronger consistently, you have to be willing to go to lengths others wouldn’t dare. to stimulate new growth and transcend your physical limitations you have to push through on the heaviest and hardest sets, and learn to embrace the pain. you learn to love the pain of your muscles straining and burning, because you’ve come to understand, that is how you grow. to bring about new development, you must grow comfortable with being uncomfortable… you’ve gotta embrace the pain.when we formulated animal fury, we had that rare mindset in mind. we set out to design a no-nonsense pre-workout powder keg that could help serious lifters stay locked in “the zone”. combining proven pre-training staples like citrulline malate, beta alanine, l-tyrosine and caffeine anhydrous all in efficacious doses with a whopping five grams of branched-chain amino acids (bcaa), every scoop of animal fury packs one hell of a muscle-building punch. performance. focus. energy. that hits hard. no bullshit. and utilizing no proprietary blends, you can rest assured that you know exactly what you’re getting in each loaded shaker cup of fury.impossible as it might seem, fury tastes as good as it works. in crisp and refreshing green apple and watermelon flavors, animal fury also pops with tantalizing taste. flavorful and bright, drinking animal fury is an enjoyable ritual you will look forward to with eager anticipation, coming to life and gaining sharper focus with each delicious sip. being in this game for so long, we never imagined dominating the iron could taste so damn good. animal fury made that reality.constant progress. that’s the bottom line. it isn’t a ballgame or a birthday party... it isn’t always fun. it is the beautiful and belligerent process that can make monsters out of mere mortal men and forge freaks from the flock. it takes time, discipline, consistency and a fair amount of pain, because growth of any consequence hurts. but the agony of great effort is a price worth paying for the glory of victory. it is with an understanding of the unyielding commitment of champions that we built animal fury, one potent ingredient at a time. so that when the weights challenge you, you can rise to the occasion, resolute and unafraid... prepared to dig deep... ready to bring the pain.https://redsupps.co.uk/products/animal-furyhttps://cdn.shopify.com/s/files/1/2544/1734/products/animal_fury_600x600_crop_center.jpg?v=1543507265Universal Nutrition new 1564346384435in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 27.99GBP shopify_1564346384435_15379382239283Animal fury Animal furybring the pain. the further you advance in this lifestyle, you start to realize what is truly necessary. to grow bigger and stronger consistently, you have to be willing to go to lengths others wouldn’t dare. to stimulate new growth and transcend your physical limitations you have to push through on the heaviest and hardest sets, and learn to embrace the pain. you learn to love the pain of your muscles straining and burning, because you’ve come to understand, that is how you grow. to bring about new development, you must grow comfortable with being uncomfortable… you’ve gotta embrace the pain.when we formulated animal fury, we had that rare mindset in mind. we set out to design a no-nonsense pre-workout powder keg that could help serious lifters stay locked in “the zone”. combining proven pre-training staples like citrulline malate, beta alanine, l-tyrosine and caffeine anhydrous all in efficacious doses with a whopping five grams of branched-chain amino acids (bcaa), every scoop of animal fury packs one hell of a muscle-building punch. performance. focus. energy. that hits hard. no bullshit. and utilizing no proprietary blends, you can rest assured that you know exactly what you’re getting in each loaded shaker cup of fury.impossible as it might seem, fury tastes as good as it works. in crisp and refreshing green apple and watermelon flavors, animal fury also pops with tantalizing taste. flavorful and bright, drinking animal fury is an enjoyable ritual you will look forward to with eager anticipation, coming to life and gaining sharper focus with each delicious sip. being in this game for so long, we never imagined dominating the iron could taste so damn good. animal fury made that reality.constant progress. that’s the bottom line. it isn’t a ballgame or a birthday party... it isn’t always fun. it is the beautiful and belligerent process that can make monsters out of mere mortal men and forge freaks from the flock. it takes time, discipline, consistency and a fair amount of pain, because growth of any consequence hurts. but the agony of great effort is a price worth paying for the glory of victory. it is with an understanding of the unyielding commitment of champions that we built animal fury, one potent ingredient at a time. so that when the weights challenge you, you can rise to the occasion, resolute and unafraid... prepared to dig deep... ready to bring the pain.https://redsupps.co.uk/products/animal-furyhttps://cdn.shopify.com/s/files/1/2544/1734/products/animal_fury_600x600_crop_center.jpg?v=1543507265Universal Nutrition new 1564346384435in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 27.99GBP shopify_1564346384435_15379382272051Animal fury Animal furybring the pain. the further you advance in this lifestyle, you start to realize what is truly necessary. to grow bigger and stronger consistently, you have to be willing to go to lengths others wouldn’t dare. to stimulate new growth and transcend your physical limitations you have to push through on the heaviest and hardest sets, and learn to embrace the pain. you learn to love the pain of your muscles straining and burning, because you’ve come to understand, that is how you grow. to bring about new development, you must grow comfortable with being uncomfortable… you’ve gotta embrace the pain.when we formulated animal fury, we had that rare mindset in mind. we set out to design a no-nonsense pre-workout powder keg that could help serious lifters stay locked in “the zone”. combining proven pre-training staples like citrulline malate, beta alanine, l-tyrosine and caffeine anhydrous all in efficacious doses with a whopping five grams of branched-chain amino acids (bcaa), every scoop of animal fury packs one hell of a muscle-building punch. performance. focus. energy. that hits hard. no bullshit. and utilizing no proprietary blends, you can rest assured that you know exactly what you’re getting in each loaded shaker cup of fury.impossible as it might seem, fury tastes as good as it works. in crisp and refreshing green apple and watermelon flavors, animal fury also pops with tantalizing taste. flavorful and bright, drinking animal fury is an enjoyable ritual you will look forward to with eager anticipation, coming to life and gaining sharper focus with each delicious sip. being in this game for so long, we never imagined dominating the iron could taste so damn good. animal fury made that reality.constant progress. that’s the bottom line. it isn’t a ballgame or a birthday party... it isn’t always fun. it is the beautiful and belligerent process that can make monsters out of mere mortal men and forge freaks from the flock. it takes time, discipline, consistency and a fair amount of pain, because growth of any consequence hurts. but the agony of great effort is a price worth paying for the glory of victory. it is with an understanding of the unyielding commitment of champions that we built animal fury, one potent ingredient at a time. so that when the weights challenge you, you can rise to the occasion, resolute and unafraid... prepared to dig deep... ready to bring the pain.https://redsupps.co.uk/products/animal-furyhttps://cdn.shopify.com/s/files/1/2544/1734/products/animal_fury_600x600_crop_center.jpg?v=1543507265Universal Nutrition new 1564346384435in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 27.99GBP shopify_1564346384435_15379382304819Animal fury Animal furybring the pain. the further you advance in this lifestyle, you start to realize what is truly necessary. to grow bigger and stronger consistently, you have to be willing to go to lengths others wouldn’t dare. to stimulate new growth and transcend your physical limitations you have to push through on the heaviest and hardest sets, and learn to embrace the pain. you learn to love the pain of your muscles straining and burning, because you’ve come to understand, that is how you grow. to bring about new development, you must grow comfortable with being uncomfortable… you’ve gotta embrace the pain.when we formulated animal fury, we had that rare mindset in mind. we set out to design a no-nonsense pre-workout powder keg that could help serious lifters stay locked in “the zone”. combining proven pre-training staples like citrulline malate, beta alanine, l-tyrosine and caffeine anhydrous all in efficacious doses with a whopping five grams of branched-chain amino acids (bcaa), every scoop of animal fury packs one hell of a muscle-building punch. performance. focus. energy. that hits hard. no bullshit. and utilizing no proprietary blends, you can rest assured that you know exactly what you’re getting in each loaded shaker cup of fury.impossible as it might seem, fury tastes as good as it works. in crisp and refreshing green apple and watermelon flavors, animal fury also pops with tantalizing taste. flavorful and bright, drinking animal fury is an enjoyable ritual you will look forward to with eager anticipation, coming to life and gaining sharper focus with each delicious sip. being in this game for so long, we never imagined dominating the iron could taste so damn good. animal fury made that reality.constant progress. that’s the bottom line. it isn’t a ballgame or a birthday party... it isn’t always fun. it is the beautiful and belligerent process that can make monsters out of mere mortal men and forge freaks from the flock. it takes time, discipline, consistency and a fair amount of pain, because growth of any consequence hurts. but the agony of great effort is a price worth paying for the glory of victory. it is with an understanding of the unyielding commitment of champions that we built animal fury, one potent ingredient at a time. so that when the weights challenge you, you can rise to the occasion, resolute and unafraid... prepared to dig deep... ready to bring the pain.https://redsupps.co.uk/products/animal-furyhttps://cdn.shopify.com/s/files/1/2544/1734/products/animal_fury_600x600_crop_center.jpg?v=1543507265Universal Nutrition new 1564346384435in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 27.99GBP shopify_1564349005875_15379426082867Animal juiced aminos Animal juiced aminosget on the juice. as you know, we’re already hooked. intraworkout, mixed in rage xl before training, sipped out of the requisite water gallon all day long. nothing fancy or sexy. just another tool, in mouth-watering form, to help you achieve your goals in the gym and beyond. after all, this is animal.as always, at animal, we believe in the basics. in an industry that sells you a flashy dream, we strive at all times to keep it real. and just like you know the brand new chrome-plated leg extension contraption at your local fitness megaplex will never replace the barbell squat, you know the slick marketing of the latest nutrition fad likely can’t hold a candle to the staples. there’s a reason weightlifting athletes have been supplementing with amino acids for more than half a century. because they work. the building blocks of protein, the foundational fuel for all muscle tissue growth, there’s nothing more crucial.that said, if an amino product was going to be animal, if it were going to garner that trusted stamp of approval, and reach that threshold of no-nonsense excellence, it would need to be serious. efficacious doses of the most critical anabolic amino acids—bcaas and eaas, gassed up by the inclusion of premium, prized, patented complementary amino compounds, delicious, refreshing taste allowing for ease of use… all with no unnecessary fillers or frills. just the basics, instantized for easy mixing, delivered raw and uncut from the name you’ve trusted since 1983. that’s animal juiced aminos.the all-new animal juiced aminos is a powerful amino acid stack that is targeted and strategically enhanced for strength training athletes. what does it contain? each jacked-up scoop of juiced aminos is loaded with instantized branch chained amino acids (bcaa), essential amino acids (eaa), in addition to performance and recovery aminos and key patented aminos.animal juiced aminos contains a scientifically tested 2:1:1 ratio of bcaa in instantized form. what does instantized mean? it means that the bcaa in juiced aminos are able to quickly disperse in water and not clump up. juiced aminos can be quickly mixed up in a shaker cup or even with a just a spoon and water. and bcaa are as tried and true as it gets when it comes to aminos. they have both anabolic and anti-catabolic benefits. bcaa are anabolic because of their ability to significantly increase protein synthesis, support hormones such as growth hormone, igf-1 and insulin, and also help to maintain a favorable testosterone to cortisol ratio. on the anti-catabolic side, bcaa can help prevent protein breakdown and muscle loss. bodybuilders and athletes because of the fact that they train hard and often follow strict dieting protocols, have a great need for supplement with bcaa. the three amino acids that constitute the bcaa are leucine, isoleucine and valine. led by leucine, the trigger of the anabolic drive, this trio of protein building blocks is proven to build muscle, maintain lean mass when in a caloric deficit, improve endurance and boost recovery—properties absolutely vital to dedicated physique artists of all levels of experience.next up in juiced aminos are the additional essential amino acids (eaa). the bcaa make up three of the naturally occurring eaa, but with juiced aminos, you get a full, comprehensive eaa profile. it’s designed to deliver the correct ratios of key essential amino acids required for igniting the anabolic drive via increased muscle protein synthesis and decreased muscle protein breakdown. research suggests that following resistance exercise, only eaa are needed to spark protein synthesis as the non-essential amino acids (neaa) are not required. what makes juiced aminos superior to other amino products is that it contains the right forms of eaa. by using only special free form eaa, juiced aminos delivers those critical aminos fast to your muscles.that covers the eaa and bcaa. but juiced aminos doesn’t stop there. this powerful formula is rounded out by a mixture of additional performance and recovery-based amino acids, called the juiced aa performance blend. these ergogenic amino acids, along with the bcaa and eaa, help to not only maximize gym performance but also promote recovery at the same time. citrulline malate has been suggested to support plasma arginine levels and nitric oxide even more efficiently than arginine itself. the physiological effect of boosting no as citrulline malate does, allows for better regulation of blood flow and amino acid delivery to muscle tissue, improved oxygen delivery, enhanced glucose uptake and muscle strength. citrulline malate also plays a role in reduced lactic acid and ammonia buildup, optimized atp production, decreased muscle fatigue and helps promote endurance. at the forefront of essential amino acid research and development with the launch of animal nitro in 2004, animal has been touting and standing behind the undeniable muscle-building benefits of eaas for more than a decade.a no-brainer addition to animal juiced aminos was l-glutamine, the most abundant amino acid in the body. it comprises more than 60% of the free amino acid pool in skeletal muscle and greater than 20% of total circulating amino acids and is used not only by skeletal muscle but also the immune system and gut in order to maintain homeostasis. strenuous exercise can deplete the body’s glutamine stores at a faster rate than they can be replenished, making it an important amino acid for athletes to consume. it’s especially important for assisting hard training athletes with reducing muscle soreness and rebuilding muscle tissue after intense training sessions. glutamine also plays an important role in protein metabolism and cell volumization, both key for continued intense training sessions. juiced aminos also contains l-taurine, which is the second most abundant amino acid in muscle. l-taurine has the ability to expand muscle cells by helping the cell itself hold more water and and results in increased cell volumization. for bodybuilders and strength athletes, this is of utmost important as expanded muscle cells can boost hydration which results in a higher rate of protein synthesis.rounding out the juiced aa performance blend are four key patented aminos; agmapure glycocarn, arginocarn and sustamine. kicking things off, agmapure agmatine sulfate is a unique amino acid in that it helps improve nutrient partitioning leading to greater glycogen storage and increased water retention within the muscle. it also helps boost nitric oxide (no), which can leads to great pumps during the workout.the second patented ingredient, glycocarn is a powerful, research-backed form of carnitine made up of glycine propionyl l-carnitine hcl. ongoing research indicates that, along with its ability to be a nitric oxide booster, this compound may be associated with improved high intensity exercise performance. the performance effects of glycocarn may be a result of both its nitric oxide boosting properties, as well as its antioxidant activity, ultimately leading to increased blood flow and enhanced atp energy production. in addition, l-carnitine has been shown to increase hormonal responses to resistance exercise and recovery and resulted in a greater number of intact receptors for hormonal interactions.the third patented nutrient, arginocarn is another research-backed form of carnitine. arginocarn is made up of acetyl-l-carnitine arginate dichloride. research shows that this powerful compound helps increase growth & repair of neurons, supports brain-to-muscle connection, boosts cognitive function and memory and can even enhance fat burning during calorie restriction via increased mitochondrial use of fatty acids. arginocarn provides a boost in increased blood flow, performance and muscle recovery assistance, heightened stamina, amongst a number of other additional benefits. it helps both in and out of the gym.the final ingredient to round out the juiced aa performance blend is sustamine. sustamine is a special dipeptide with benefits that include the ability to promote protein synthesis and stimulate immune action in addition to showcasing the ability to supply energy and promote healthy hydration. sustamine and its ability to promote better hydration is its key action. better hydration for athletes means better pumps and ability to transport nutrients to your cells and transport waste out of the body.initially available in orange juiced, grape juiced and strawberry limeade flavors, animal juiced aminos is a versatile powder that can be used pre-, intra-, post- or even sipped on over the course of the day allowing for the steady intake of critical anabolic nutrients. this steady stream of high octane, juiced-up aminos coursing through your veins is sure to support the most rigorous, balls-out battles with the iron. ..which has been the animal mission statement since day one—to supply the hardest-training strength athletes in the world with the tools they demand to reach their goals. the latest in a long and storied lineage of dead serious bodybuilding products, each geared-up scoop of animal juiced aminos lives up to that heritage of hardcore. get on the juice.https://redsupps.co.uk/products/animal-juiced-aminoshttps://cdn.shopify.com/s/files/1/2544/1734/products/juiced_aminos_600x600_crop_center.jpg?v=1543507268Universal Nutrition new 1564349005875in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids 27.99GBP shopify_1564349005875_15379426115635Animal juiced aminos Animal juiced aminosget on the juice. as you know, we’re already hooked. intraworkout, mixed in rage xl before training, sipped out of the requisite water gallon all day long. nothing fancy or sexy. just another tool, in mouth-watering form, to help you achieve your goals in the gym and beyond. after all, this is animal.as always, at animal, we believe in the basics. in an industry that sells you a flashy dream, we strive at all times to keep it real. and just like you know the brand new chrome-plated leg extension contraption at your local fitness megaplex will never replace the barbell squat, you know the slick marketing of the latest nutrition fad likely can’t hold a candle to the staples. there’s a reason weightlifting athletes have been supplementing with amino acids for more than half a century. because they work. the building blocks of protein, the foundational fuel for all muscle tissue growth, there’s nothing more crucial.that said, if an amino product was going to be animal, if it were going to garner that trusted stamp of approval, and reach that threshold of no-nonsense excellence, it would need to be serious. efficacious doses of the most critical anabolic amino acids—bcaas and eaas, gassed up by the inclusion of premium, prized, patented complementary amino compounds, delicious, refreshing taste allowing for ease of use… all with no unnecessary fillers or frills. just the basics, instantized for easy mixing, delivered raw and uncut from the name you’ve trusted since 1983. that’s animal juiced aminos.the all-new animal juiced aminos is a powerful amino acid stack that is targeted and strategically enhanced for strength training athletes. what does it contain? each jacked-up scoop of juiced aminos is loaded with instantized branch chained amino acids (bcaa), essential amino acids (eaa), in addition to performance and recovery aminos and key patented aminos.animal juiced aminos contains a scientifically tested 2:1:1 ratio of bcaa in instantized form. what does instantized mean? it means that the bcaa in juiced aminos are able to quickly disperse in water and not clump up. juiced aminos can be quickly mixed up in a shaker cup or even with a just a spoon and water. and bcaa are as tried and true as it gets when it comes to aminos. they have both anabolic and anti-catabolic benefits. bcaa are anabolic because of their ability to significantly increase protein synthesis, support hormones such as growth hormone, igf-1 and insulin, and also help to maintain a favorable testosterone to cortisol ratio. on the anti-catabolic side, bcaa can help prevent protein breakdown and muscle loss. bodybuilders and athletes because of the fact that they train hard and often follow strict dieting protocols, have a great need for supplement with bcaa. the three amino acids that constitute the bcaa are leucine, isoleucine and valine. led by leucine, the trigger of the anabolic drive, this trio of protein building blocks is proven to build muscle, maintain lean mass when in a caloric deficit, improve endurance and boost recovery—properties absolutely vital to dedicated physique artists of all levels of experience.next up in juiced aminos are the additional essential amino acids (eaa). the bcaa make up three of the naturally occurring eaa, but with juiced aminos, you get a full, comprehensive eaa profile. it’s designed to deliver the correct ratios of key essential amino acids required for igniting the anabolic drive via increased muscle protein synthesis and decreased muscle protein breakdown. research suggests that following resistance exercise, only eaa are needed to spark protein synthesis as the non-essential amino acids (neaa) are not required. what makes juiced aminos superior to other amino products is that it contains the right forms of eaa. by using only special free form eaa, juiced aminos delivers those critical aminos fast to your muscles.that covers the eaa and bcaa. but juiced aminos doesn’t stop there. this powerful formula is rounded out by a mixture of additional performance and recovery-based amino acids, called the juiced aa performance blend. these ergogenic amino acids, along with the bcaa and eaa, help to not only maximize gym performance but also promote recovery at the same time. citrulline malate has been suggested to support plasma arginine levels and nitric oxide even more efficiently than arginine itself. the physiological effect of boosting no as citrulline malate does, allows for better regulation of blood flow and amino acid delivery to muscle tissue, improved oxygen delivery, enhanced glucose uptake and muscle strength. citrulline malate also plays a role in reduced lactic acid and ammonia buildup, optimized atp production, decreased muscle fatigue and helps promote endurance. at the forefront of essential amino acid research and development with the launch of animal nitro in 2004, animal has been touting and standing behind the undeniable muscle-building benefits of eaas for more than a decade.a no-brainer addition to animal juiced aminos was l-glutamine, the most abundant amino acid in the body. it comprises more than 60% of the free amino acid pool in skeletal muscle and greater than 20% of total circulating amino acids and is used not only by skeletal muscle but also the immune system and gut in order to maintain homeostasis. strenuous exercise can deplete the body’s glutamine stores at a faster rate than they can be replenished, making it an important amino acid for athletes to consume. it’s especially important for assisting hard training athletes with reducing muscle soreness and rebuilding muscle tissue after intense training sessions. glutamine also plays an important role in protein metabolism and cell volumization, both key for continued intense training sessions. juiced aminos also contains l-taurine, which is the second most abundant amino acid in muscle. l-taurine has the ability to expand muscle cells by helping the cell itself hold more water and and results in increased cell volumization. for bodybuilders and strength athletes, this is of utmost important as expanded muscle cells can boost hydration which results in a higher rate of protein synthesis.rounding out the juiced aa performance blend are four key patented aminos; agmapure glycocarn, arginocarn and sustamine. kicking things off, agmapure agmatine sulfate is a unique amino acid in that it helps improve nutrient partitioning leading to greater glycogen storage and increased water retention within the muscle. it also helps boost nitric oxide (no), which can leads to great pumps during the workout.the second patented ingredient, glycocarn is a powerful, research-backed form of carnitine made up of glycine propionyl l-carnitine hcl. ongoing research indicates that, along with its ability to be a nitric oxide booster, this compound may be associated with improved high intensity exercise performance. the performance effects of glycocarn may be a result of both its nitric oxide boosting properties, as well as its antioxidant activity, ultimately leading to increased blood flow and enhanced atp energy production. in addition, l-carnitine has been shown to increase hormonal responses to resistance exercise and recovery and resulted in a greater number of intact receptors for hormonal interactions.the third patented nutrient, arginocarn is another research-backed form of carnitine. arginocarn is made up of acetyl-l-carnitine arginate dichloride. research shows that this powerful compound helps increase growth & repair of neurons, supports brain-to-muscle connection, boosts cognitive function and memory and can even enhance fat burning during calorie restriction via increased mitochondrial use of fatty acids. arginocarn provides a boost in increased blood flow, performance and muscle recovery assistance, heightened stamina, amongst a number of other additional benefits. it helps both in and out of the gym.the final ingredient to round out the juiced aa performance blend is sustamine. sustamine is a special dipeptide with benefits that include the ability to promote protein synthesis and stimulate immune action in addition to showcasing the ability to supply energy and promote healthy hydration. sustamine and its ability to promote better hydration is its key action. better hydration for athletes means better pumps and ability to transport nutrients to your cells and transport waste out of the body.initially available in orange juiced, grape juiced and strawberry limeade flavors, animal juiced aminos is a versatile powder that can be used pre-, intra-, post- or even sipped on over the course of the day allowing for the steady intake of critical anabolic nutrients. this steady stream of high octane, juiced-up aminos coursing through your veins is sure to support the most rigorous, balls-out battles with the iron. ..which has been the animal mission statement since day one—to supply the hardest-training strength athletes in the world with the tools they demand to reach their goals. the latest in a long and storied lineage of dead serious bodybuilding products, each geared-up scoop of animal juiced aminos lives up to that heritage of hardcore. get on the juice.https://redsupps.co.uk/products/animal-juiced-aminoshttps://cdn.shopify.com/s/files/1/2544/1734/products/juiced_aminos_600x600_crop_center.jpg?v=1543507268Universal Nutrition new 1564349005875in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids 27.99GBP shopify_1564349005875_15379426148403Animal juiced aminos Animal juiced aminosget on the juice. as you know, we’re already hooked. intraworkout, mixed in rage xl before training, sipped out of the requisite water gallon all day long. nothing fancy or sexy. just another tool, in mouth-watering form, to help you achieve your goals in the gym and beyond. after all, this is animal.as always, at animal, we believe in the basics. in an industry that sells you a flashy dream, we strive at all times to keep it real. and just like you know the brand new chrome-plated leg extension contraption at your local fitness megaplex will never replace the barbell squat, you know the slick marketing of the latest nutrition fad likely can’t hold a candle to the staples. there’s a reason weightlifting athletes have been supplementing with amino acids for more than half a century. because they work. the building blocks of protein, the foundational fuel for all muscle tissue growth, there’s nothing more crucial.that said, if an amino product was going to be animal, if it were going to garner that trusted stamp of approval, and reach that threshold of no-nonsense excellence, it would need to be serious. efficacious doses of the most critical anabolic amino acids—bcaas and eaas, gassed up by the inclusion of premium, prized, patented complementary amino compounds, delicious, refreshing taste allowing for ease of use… all with no unnecessary fillers or frills. just the basics, instantized for easy mixing, delivered raw and uncut from the name you’ve trusted since 1983. that’s animal juiced aminos.the all-new animal juiced aminos is a powerful amino acid stack that is targeted and strategically enhanced for strength training athletes. what does it contain? each jacked-up scoop of juiced aminos is loaded with instantized branch chained amino acids (bcaa), essential amino acids (eaa), in addition to performance and recovery aminos and key patented aminos.animal juiced aminos contains a scientifically tested 2:1:1 ratio of bcaa in instantized form. what does instantized mean? it means that the bcaa in juiced aminos are able to quickly disperse in water and not clump up. juiced aminos can be quickly mixed up in a shaker cup or even with a just a spoon and water. and bcaa are as tried and true as it gets when it comes to aminos. they have both anabolic and anti-catabolic benefits. bcaa are anabolic because of their ability to significantly increase protein synthesis, support hormones such as growth hormone, igf-1 and insulin, and also help to maintain a favorable testosterone to cortisol ratio. on the anti-catabolic side, bcaa can help prevent protein breakdown and muscle loss. bodybuilders and athletes because of the fact that they train hard and often follow strict dieting protocols, have a great need for supplement with bcaa. the three amino acids that constitute the bcaa are leucine, isoleucine and valine. led by leucine, the trigger of the anabolic drive, this trio of protein building blocks is proven to build muscle, maintain lean mass when in a caloric deficit, improve endurance and boost recovery—properties absolutely vital to dedicated physique artists of all levels of experience.next up in juiced aminos are the additional essential amino acids (eaa). the bcaa make up three of the naturally occurring eaa, but with juiced aminos, you get a full, comprehensive eaa profile. it’s designed to deliver the correct ratios of key essential amino acids required for igniting the anabolic drive via increased muscle protein synthesis and decreased muscle protein breakdown. research suggests that following resistance exercise, only eaa are needed to spark protein synthesis as the non-essential amino acids (neaa) are not required. what makes juiced aminos superior to other amino products is that it contains the right forms of eaa. by using only special free form eaa, juiced aminos delivers those critical aminos fast to your muscles.that covers the eaa and bcaa. but juiced aminos doesn’t stop there. this powerful formula is rounded out by a mixture of additional performance and recovery-based amino acids, called the juiced aa performance blend. these ergogenic amino acids, along with the bcaa and eaa, help to not only maximize gym performance but also promote recovery at the same time. citrulline malate has been suggested to support plasma arginine levels and nitric oxide even more efficiently than arginine itself. the physiological effect of boosting no as citrulline malate does, allows for better regulation of blood flow and amino acid delivery to muscle tissue, improved oxygen delivery, enhanced glucose uptake and muscle strength. citrulline malate also plays a role in reduced lactic acid and ammonia buildup, optimized atp production, decreased muscle fatigue and helps promote endurance. at the forefront of essential amino acid research and development with the launch of animal nitro in 2004, animal has been touting and standing behind the undeniable muscle-building benefits of eaas for more than a decade.a no-brainer addition to animal juiced aminos was l-glutamine, the most abundant amino acid in the body. it comprises more than 60% of the free amino acid pool in skeletal muscle and greater than 20% of total circulating amino acids and is used not only by skeletal muscle but also the immune system and gut in order to maintain homeostasis. strenuous exercise can deplete the body’s glutamine stores at a faster rate than they can be replenished, making it an important amino acid for athletes to consume. it’s especially important for assisting hard training athletes with reducing muscle soreness and rebuilding muscle tissue after intense training sessions. glutamine also plays an important role in protein metabolism and cell volumization, both key for continued intense training sessions. juiced aminos also contains l-taurine, which is the second most abundant amino acid in muscle. l-taurine has the ability to expand muscle cells by helping the cell itself hold more water and and results in increased cell volumization. for bodybuilders and strength athletes, this is of utmost important as expanded muscle cells can boost hydration which results in a higher rate of protein synthesis.rounding out the juiced aa performance blend are four key patented aminos; agmapure glycocarn, arginocarn and sustamine. kicking things off, agmapure agmatine sulfate is a unique amino acid in that it helps improve nutrient partitioning leading to greater glycogen storage and increased water retention within the muscle. it also helps boost nitric oxide (no), which can leads to great pumps during the workout.the second patented ingredient, glycocarn is a powerful, research-backed form of carnitine made up of glycine propionyl l-carnitine hcl. ongoing research indicates that, along with its ability to be a nitric oxide booster, this compound may be associated with improved high intensity exercise performance. the performance effects of glycocarn may be a result of both its nitric oxide boosting properties, as well as its antioxidant activity, ultimately leading to increased blood flow and enhanced atp energy production. in addition, l-carnitine has been shown to increase hormonal responses to resistance exercise and recovery and resulted in a greater number of intact receptors for hormonal interactions.the third patented nutrient, arginocarn is another research-backed form of carnitine. arginocarn is made up of acetyl-l-carnitine arginate dichloride. research shows that this powerful compound helps increase growth & repair of neurons, supports brain-to-muscle connection, boosts cognitive function and memory and can even enhance fat burning during calorie restriction via increased mitochondrial use of fatty acids. arginocarn provides a boost in increased blood flow, performance and muscle recovery assistance, heightened stamina, amongst a number of other additional benefits. it helps both in and out of the gym.the final ingredient to round out the juiced aa performance blend is sustamine. sustamine is a special dipeptide with benefits that include the ability to promote protein synthesis and stimulate immune action in addition to showcasing the ability to supply energy and promote healthy hydration. sustamine and its ability to promote better hydration is its key action. better hydration for athletes means better pumps and ability to transport nutrients to your cells and transport waste out of the body.initially available in orange juiced, grape juiced and strawberry limeade flavors, animal juiced aminos is a versatile powder that can be used pre-, intra-, post- or even sipped on over the course of the day allowing for the steady intake of critical anabolic nutrients. this steady stream of high octane, juiced-up aminos coursing through your veins is sure to support the most rigorous, balls-out battles with the iron. ..which has been the animal mission statement since day one—to supply the hardest-training strength athletes in the world with the tools they demand to reach their goals. the latest in a long and storied lineage of dead serious bodybuilding products, each geared-up scoop of animal juiced aminos lives up to that heritage of hardcore. get on the juice.https://redsupps.co.uk/products/animal-juiced-aminoshttps://cdn.shopify.com/s/files/1/2544/1734/products/juiced_aminos_600x600_crop_center.jpg?v=1543507268Universal Nutrition new 1564349005875in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids 27.99GBP shopify_1484213354547_13366790848563Animal m-stak  detailsfor many of us, the difficulty wasn’t the initial response to weightlifting, that helped us rapidly change our bodies, and our lifestyles along with it. the challenge came, when our growth stagnated. and our gains plateaued. for many, that turning point moment is where there training lives came to an unceremonious end. but not for us. for those few who were too in love with the iron to ever just walk away, we dedicated ourselves in earnest to breaking through that plateau. it was this urge that inspired the brothers at animal to formulate the highly anabolic m-stak.what is anabolic? muscle building and the processes that lead us down the road to new growth… protein synthesis. nitrogen retention. nutrient-partitioning. what is animal m-stak? a natural, non-hormonal supplement designed for the most stubborn of all 'hardgainers.' from green beginner to diehard vet, we’ve all gone through it – skidding to a halt, our progress idles on a plateau. can’t gain another pound, workouts are stale, lifts are static. this is the hardgainer’s syndrome, and from the most slender of ectomorphs to the most muscular endomorph, we’ve all been there. desperate to ignite new growth, we’ll try almost anything. for those of us so dedicated to the iron game, these moments of frustration have come to an end in the form of animal m-stak.m-stak is built on a foundation of natural anabolic flavones born from eastern european athletic studies. these special flavones have long been theorized to help enhance targeted gains in lean muscle mass. m-stak combines the most powerful of these anabolic compounds in significant dosages, making the long storied anabolic potential of the product all the greater. primary among these flavones are beta-ecdysterone (cyanotis vaga) and 5-methyl-y-methoxyisoflavone. these ingredients have the ability to shuttle nutrients specifically towards lean mass accumulation, a process known as 'nutrient partitioning.' the anabolic flavones in m-stak can also help promote enhanced protein synthesis and nitrogen retention. next up are ajuga turkestanica and beta sitosterol. ajuga turkestanica contains the potent phytosteroid, turkesterone, believed to be extremely powerful in accelerating protein synthesis. beta sitosterol, while having its own inherent anabolic potential, helps promote a healthy immune system and may also help support healthy cortisol levels already within normal range.with m-stak, you also get a powerful anti-catabolic amino blend. with advanced forms of leucine and the other bcaas spearheading the mixture, these aminos work from a cellular level to directly stimulate protein synthesis. studies suggest that by adding leucine along with a protein/carb meal, you get even greater whole body net protein balance than just consuming protein and carbs alone. these aminos help to stimulate muscle recovery and protein synthesis via translation regulations, all through non-hormonal means. these aminos essentially work as a signal for turning on the muscle building process, supporting increased muscle anabolism following a training session.we’ve also included key 'anabolic adaptogens' such as safed musli, muira puama, and the isoflavones from kudzu. together these natural herbs and extracts have been suggested to help increase physical training capacity, improve endurance, minimize the catabolic stress response, decrease mental fatigue as well as support sexual health and boost support system function. these are critical factors for naturally enhancing ones performance levels in the gym.you also get powerful insulin potentiators which work to support insulin production already within healthy range – compounds designed to help your body to utilize ultra anabolic insulin both effectively and efficiently for supporting muscle growth. this equates to increased uptake of glycogen and increased muscle cell volume which contributes to that full, pumped feeling when you workout. m-stak also delivers a potent energy blend, packed with powerful, natural stimulants designed to propel you through even the most grueling of training sessions. the addition of this complex, easily identifiable by its red capsule, makes m-stak perfect for pre-training, lighting a fire under that we all need from time to time.finally, m-stak’s m-factor transport complex works to promote nutrient utilization to ensure the powerful components of the formula are processed to maximum efficacy. using ginger root extract coupled with the powerful absorption enhancers 6,7-dihydroxybergmottin and piper nigrum extract, you can be sure that the myriad growth factors in the m-stak formula are working to their full capacity and are not going to waste.m-stak floods your system with an abundance of anabolic nutrients, switching your muscle-building signals on and amplifying them. combining flavones and sterones in hefty doses with the most anabolic of amino blends supported by an array of cutting-edge adaptogens in a single pre-training pack designed for optimum absorption and convenience, the new animal m-stak takes non-hormonal lean mass nutrient partitioning to a whole new level. animal m-stak, the non-hormonal anabolic stack, has come to turn 'hardgainers' into 'hard' gainers.https://redsupps.co.uk/products/animal-m-stakhttps://cdn.shopify.com/s/files/1/2544/1734/products/a_m_stak_600x600_crop_center.png?v=1543507270Universal Nutrition new 1484213354547in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsNatural Anabolic 35.99GBP shopify_1564351332403_15379459538995Animal nitro animal nitrorecovery is the name of the game. you’re only as good, as you can recover. the hardest workouts, the heaviest weights, the strictest diet program, all mean very little if you can’t rebuild and repair torn down muscle tissue, bigger and stronger than before. the weights are only a catalyst. protein and amino acids, when processed correctly and efficiently, can trigger the development of the bigger and stronger muscle tissue.by now, you know the value of amino acids. aminos are the basic building blocks of muscle. aminos can also trigger anabolism, the cornerstone of muscle growth. there are nearly two dozen amino acids, but only a select few are absolutely “essential” for igniting the anabolic drive, as the research has shown. not surprisingly, these key essential aminos (eaa) are the same ones found in human muscle. animal nitro is the first and only supplement that contains the correct ratios of those aminos based on human muscle protein itself—the human muscle protein complex (hmpc). hmpc consists of special uncoupled aminos exclusively (those that are free of the chemical bonds that can limit maximum utilization). by using only 100% uncoupled aminos in hmpc, animal nitro delivers a precisely controlled dose of aminos that are targeted to efficiently enter systemic circulation. and that's where the muscle-building transaction is paid in full. each pack consists of a measured 6,000 mg dose of uncoupled aminos. once ingested, they quickly form a special bolus (a protective mass) that allows them to efficiently bypass the liver. once past the liver, this bolus enters systemic circulation, where they can exert their powerful effects. when combined with serious resistance training, animal nitro can actually help your body deliver more nutrients to your working muscles, recover more quickly, and build new muscle mass by enhancing protein synthesis, improving net muscle protein balance, and preventing muscle breakdown.as no-nonsense as the no-bullshit animal line of bodybuilding supplements gets, animal nitro is the truth. simple packs of nine white capsules, loaded to the hilt with power-packed essential amino acids. gram for gram, nothing is as pure, as efficient, as potent, and as effective as animal nitro. it's the gold standard among amino-based formulas, and the forerunner in eaa supplementation. place the building blocks in the proper place, and watch your structure grow in stature. one workout, one meal, one pack of animal nitro at a time.https://redsupps.co.uk/products/animal-nitrohttps://cdn.shopify.com/s/files/1/2544/1734/products/animal_nitro_600x600_crop_center.png?v=1543507286Universal Nutrition new 1564351332403in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids 39.99GBP shopify_1620761477171_15827045482547Animal omega In recent years, essential fatty acids, especially fish oil, have come to the forefront in terms of general health supplementation for the mainstream masses. but those of our ilk, already massive or seeking to add mass, can also benefit in myriad ways from adding efas to their nutritional program. it is with this fact in mind that we formulated animal omega.animal omega is a full spectrum, comprehensive essential fatty acid (efa) product uniquely formulated for the serious strength athlete and lifter. animal omega comes enhanced with sesamin, along with a precise, controlled, pre-dosed ratio of n-3 and n-6 fatty acids including epa, dha and cla, providing much-needed healthy and absolutely essential fats to a dedicated iron athlete’s lean and clean protein and carbohydrate-heavy nutritional program.essential fatty acids, made famous in the mainstream by the popularity and proliferation of fish oil supplements for general health, have numerous benefits for weightlifters including enhancing metabolism and bettering body composition, improving cardiovascular health, optimising natural hormone production and fighting training-related inflammation which can dramatically benefit joint health and function. few supplements can be so beneficial for serious lifters in so many ways.a single serving of animal omega includes a robust daily dose of omega-3 and omega-6 efas, including an array of fish oils (salmon, cod liver, herring, anchovy, mackerel, sardine) and old school bodybuilding staples like flax, safflower, and borage oil. in one conveniently pre-dosed pack, you get all of the powerhouse efas you need (the kinds your body can't manufacture) to supplement your whole food-diet, to stay healthy while growing and performing optimally.essential fatty acid supplementation is only now overlooked at the detriment of the dedicated lifter. these critical dietary details can no longer be overlooked when it comes to optimising overall health, and consequently, muscle growth and performance. for this most obvious reason we formulated animal omega.https://redsupps.co.uk/products/animal-omegahttps://cdn.shopify.com/s/files/1/2544/1734/products/1_600x600_crop_center.jpg?v=1543922089Universal Nutrition new 1620761477171in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsFat Acids Formula 27.99GBP shopify_1469488988211_13227387584563Animal pak  descriptionthe true original since 1983, the animal pak was developed to cover the wide backs of the hardest and heaviest trainers on the planet earth. the “ultimate training pack” is far more than a mere multivitamin, but is the trusted, sturdy foundation upon which the most dedicated bodybuilders and powerlifters have built their nutritional regimens, since the supplement industry was in its mere infancy.if you're training or dieting hard for a contest, the first thing that happens when you don't take the animal pak is that nutritional gaps begin to form. why should you care? because over time, these deficiencies continue to grow. eventually, your body will stop functioning at its optimum level. in other words, you hit the wall, your development reaches a plateau. in fact, even if only one key nutrient is missing from your diet, your body could shut down the anabolic drive needed to build muscle so that it can support more critical metabolic processes. when this happens, you stop growing.research has proven that strength athletes such as bodybuilders and powerlifters, due to the intensity and frequency of their training programs, have higher nutritional requirements than regular athletes. studies have shown that these unique needs are greatly increased for bodybuilders who regularly compete and need to diet down. during calorie-restricted diets (diets which tend to be repetitive and monotonous, e.g., rice and chicken), the potential for nutritional deficiencies increase dramatically.more alarming is the fact that championship-caliber bodybuilders, even when supplementing with a regular multivitamin, were still experiencing significant nutritional deficiencies. a basic multivitamin supplement won't be enough. competitive bodybuilders know that a superior multivitamin is the first line of defense. this fact is confirmed by studies which have revealed that 100% of olympic weightlifters and over 90% of competitive male and female bodybuilders use a vitamin/mineral supplement like animal pak.these nutritional gaps not only affect your performance and size, but they begin to impact the way your other supplements work. for many of today's supplements to work efficiently, your body needs to be running on all cylinders. nutritional gaps mean that your supplements may be rendered ineffective. for example, many supplements rely on enzymes and other substances in your body to "activate" them. poor nutrition means poor conversion and activation of expensive supplements. animal pak is your insurance policy to prevent this from happening. the pak helps ensure you are maintaining an anabolic internal environment, one primed for muscle growth and optimum performance.with animal pak, you get plenty of everything you need. and a few extras. in every pack, you get a vast arsenal of over 60 key ingredients that are delivered in the right amounts at the right time, every time. each of the 11 tablets included in each pack has been specifically formulated to deliver the goods—ample doses of vitamins, minerals, amino acids, herbs and other performance optimizers designed to stand up to the most intense training and rigorous dieting.consider the animal pak as the cast iron skillet of your supplement program, your body's first line of defense. if you train with weights, then you absolutely need to train with the animal pak. remember, while most supplements have come and gone, precious few have stood the test of time. when you're ready for the best, step up to the most trusted name in serious bodybuilding nutrition: animal pak. what ifbb pros and mr. olympia competitors have used since '83. what the best of the best depend on, when the going gets tough, and every set, rep and meal matters the most.. the legendary animal pak.https://redsupps.co.uk/products/animal-pakhttps://cdn.shopify.com/s/files/1/2544/1734/products/Animal_Pak_i2380_d1200x1200_600x600_crop_center.jpg?v=1543507289Universal Nutrition new 1469488988211in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMultivitamin 29.99GBP shopify_1564354248755_15379516129331Animal pak powder animal pak powderthe true original since 1983, the animal pak was developed to cover the wide backs of the hardest and heaviest trainers on the planet earth. the “ultimate training pack” is far more than a mere multivitamin, but is the trusted, sturdy foundation upon which the most dedicated bodybuilders and powerlifters have built their nutritional regimens, since the supplement industry was in its mere infancy.if you're training or dieting hard for a contest, the first thing that happens when you don't take the animal pak is that nutritional gaps begin to form. why should you care? because over time, these deficiencies continue to grow. eventually, your body will stop functioning at its optimum level. in other words, you hit the wall, your development reaches a plateau. in fact, even if only one key nutrient is missing from your diet, your body could shut down the anabolic drive needed to build muscle so that it can support more critical metabolic processes. when this happens, you stop growing.research has proven that strength athletes such as bodybuilders and powerlifters, due to the intensity and frequency of their training programs, have higher nutritional requirements than regular athletes. studies have shown that these unique needs are greatly increased for bodybuilders who regularly compete and need to diet down. during calorie-restricted diets (diets which tend to be repetitive and monotonous, e.g., rice and chicken), the potential for nutritional deficiencies increase dramatically.more alarming is the fact that championship-caliber bodybuilders, even when supplementing with a regular multivitamin, were still experiencing significant nutritional deficiencies. a basic multivitamin supplement won't be enough. competitive bodybuilders know that a superior multivitamin is the first line of defense. this fact is confirmed by studies which have revealed that 100% of olympic weightlifters and over 90% of competitive male and female bodybuilders use a vitamin/mineral supplement like animal pak.these nutritional gaps not only affect your performance and size, but they begin to impact the way your other supplements work. for many of today's supplements to work efficiently, your body needs to be running on all cylinders. nutritional gaps mean that your supplements may be rendered ineffective. for example, many supplements rely on enzymes and other substances in your body to "activate" them. poor nutrition means poor conversion and activation of expensive supplements. animal pak is your insurance policy to prevent this from happening. the pak helps ensure you are maintaining an anabolic internal environment, one primed for muscle growth and optimum performance.with animal pak, you get plenty of everything you need. and a few extras. in every pack, you get a vast arsenal of over 60 key ingredients that are delivered in the right amounts at the right time, every time. each of the 11 tablets included in each pack has been specifically formulated to deliver the goods—ample doses of vitamins, minerals, amino acids, herbs and other performance optimizers designed to stand up to the most intense training and rigorous dieting.consider the animal pak as the cast iron skillet of your supplement program, your body's first line of defense. if you train with weights, then you absolutely need to train with the animal pak. remember, while most supplements have come and gone, precious few have stood the test of time. when you're ready for the best, step up to the most trusted name in serious bodybuilding nutrition: animal pak. what ifbb pros and mr. olympia competitors have used since '83. what the best of the best depend on, when the going gets tough, and every set, rep and meal matters the most.. the legendary animal pak.now also available in convenient and tasty powder form. all the potent power of pak, that can be easily stacked in the same shaker cup as your whey, rage xl or juiced aminos. the true original now makes room for the new original, animal pak powder.https://redsupps.co.uk/products/animal-pak-powderhttps://cdn.shopify.com/s/files/1/2544/1734/products/animal_pak_powder_600x600_crop_center.jpg?v=1542781413Universal Nutrition new 1564354248755in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMultivitamin 29.99GBP shopify_1564354248755_15379516162099Animal pak powder animal pak powderthe true original since 1983, the animal pak was developed to cover the wide backs of the hardest and heaviest trainers on the planet earth. the “ultimate training pack” is far more than a mere multivitamin, but is the trusted, sturdy foundation upon which the most dedicated bodybuilders and powerlifters have built their nutritional regimens, since the supplement industry was in its mere infancy.if you're training or dieting hard for a contest, the first thing that happens when you don't take the animal pak is that nutritional gaps begin to form. why should you care? because over time, these deficiencies continue to grow. eventually, your body will stop functioning at its optimum level. in other words, you hit the wall, your development reaches a plateau. in fact, even if only one key nutrient is missing from your diet, your body could shut down the anabolic drive needed to build muscle so that it can support more critical metabolic processes. when this happens, you stop growing.research has proven that strength athletes such as bodybuilders and powerlifters, due to the intensity and frequency of their training programs, have higher nutritional requirements than regular athletes. studies have shown that these unique needs are greatly increased for bodybuilders who regularly compete and need to diet down. during calorie-restricted diets (diets which tend to be repetitive and monotonous, e.g., rice and chicken), the potential for nutritional deficiencies increase dramatically.more alarming is the fact that championship-caliber bodybuilders, even when supplementing with a regular multivitamin, were still experiencing significant nutritional deficiencies. a basic multivitamin supplement won't be enough. competitive bodybuilders know that a superior multivitamin is the first line of defense. this fact is confirmed by studies which have revealed that 100% of olympic weightlifters and over 90% of competitive male and female bodybuilders use a vitamin/mineral supplement like animal pak.these nutritional gaps not only affect your performance and size, but they begin to impact the way your other supplements work. for many of today's supplements to work efficiently, your body needs to be running on all cylinders. nutritional gaps mean that your supplements may be rendered ineffective. for example, many supplements rely on enzymes and other substances in your body to "activate" them. poor nutrition means poor conversion and activation of expensive supplements. animal pak is your insurance policy to prevent this from happening. the pak helps ensure you are maintaining an anabolic internal environment, one primed for muscle growth and optimum performance.with animal pak, you get plenty of everything you need. and a few extras. in every pack, you get a vast arsenal of over 60 key ingredients that are delivered in the right amounts at the right time, every time. each of the 11 tablets included in each pack has been specifically formulated to deliver the goods—ample doses of vitamins, minerals, amino acids, herbs and other performance optimizers designed to stand up to the most intense training and rigorous dieting.consider the animal pak as the cast iron skillet of your supplement program, your body's first line of defense. if you train with weights, then you absolutely need to train with the animal pak. remember, while most supplements have come and gone, precious few have stood the test of time. when you're ready for the best, step up to the most trusted name in serious bodybuilding nutrition: animal pak. what ifbb pros and mr. olympia competitors have used since '83. what the best of the best depend on, when the going gets tough, and every set, rep and meal matters the most.. the legendary animal pak.now also available in convenient and tasty powder form. all the potent power of pak, that can be easily stacked in the same shaker cup as your whey, rage xl or juiced aminos. the true original now makes room for the new original, animal pak powder.https://redsupps.co.uk/products/animal-pak-powderhttps://cdn.shopify.com/s/files/1/2544/1734/products/animal_pak_powder_600x600_crop_center.jpg?v=1542781413Universal Nutrition new 1564354248755in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMultivitamin 29.99GBP shopify_1484172787763_13366711058483Animal pump descriptionwe chase the pump, just as much as you do. on the weight room floor, it makes us feel alive. it made us fall in love with the iron in the first place. there’s nothing quite like it. and it was the pursuit of that feeling that motivated us to formulate animal pump.the “pump” is perhaps the most important physiological process as it relates to the bodybuilder and the pursuit of muscle-building. not only is it the gratifying feeling of skin-tearing fullness that keeps iron athletes returning to the gym day after day, it is also the means by which oxygen and nutrient-rich blood engorges working muscle, feeding it so that it can grow. not only does it make you look bigger, blowing up the target muscle group like a balloon, it actually makes you bigger, triggering the process of anabolism.this process of muscle volumization is critical to muscle growth. with animal pump, we at animal designed a formula specifically to “up the volume” while improving performance. animal pump was the first encapsulated pre-workout formula that contained a full daily dose of advanced creatines in each pre-dosed pack, fortified by vasodilation ingredients intended to maximize the pump by boosting nitric oxide (no) production.one of the standout points of differentiation for animal pump is that it is one of the very few encapsulated pre-workout formulas, for those who tire of the traditional powdered drink mixes. consequently, for those sensitive to caffeine or those who train at night, animal pump provides all of the stimulants in its formula in a single, easy-to-identify red capsule, further setting it apart from the competition. leave the stims in, or take them out and save them for later. the choice is yours. that's flexibility you rarely find in traditional bodybuilding supplementation. easy to use, convenient to carry in your pocket or gym bag, animal pump delivers in the gym, every time. blowing up your muscles and helping you destroy the weights, there's no feeling quite like it. animal pump... it's the pump, in a pack.https://redsupps.co.uk/products/animal-pumphttps://cdn.shopify.com/s/files/1/2544/1734/products/UNIVANPU00300000PKa-1000_600x600_crop_center.png?v=1542781421Universal Nutrition new 1484172787763in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 39.00GBP shopify_1564322070579_15379049480243Animal spiked aminos Animal spiked aminosaminos today are like what creatine was when it first hit the market. today, both are proven staples in the arsenals of all serious, dedicated weightlifters who are looking to make gains day in and day out. animal's newest product, spiked aminos, uses the highest quality free form and instantized bcaas and eaas. this perfectly balanced ratio of aminos are more readily absorbed and utilized than regular, conventional aminos. you can use animal spiked aminos any time during the day when you need a boost. as a training supplement, animal spiked aminos can help before the workout (energy/focus), during the workout (performance/ergogenic), and even after the workout (recovery). using animal spiked aminos may help support optimal exercise performance, hydration and immune health.https://redsupps.co.uk/products/animal-spiked-aminoshttps://cdn.shopify.com/s/files/1/2544/1734/products/Animal_Spiked_Aminos_i39035_d1200x1200_600x600_crop_center.png?v=1542781451Universal Nutrition new 1564322070579in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsEnergised BCAA 22.00GBP shopify_1564322070579_15379049513011Animal spiked aminos Animal spiked aminosaminos today are like what creatine was when it first hit the market. today, both are proven staples in the arsenals of all serious, dedicated weightlifters who are looking to make gains day in and day out. animal's newest product, spiked aminos, uses the highest quality free form and instantized bcaas and eaas. this perfectly balanced ratio of aminos are more readily absorbed and utilized than regular, conventional aminos. you can use animal spiked aminos any time during the day when you need a boost. as a training supplement, animal spiked aminos can help before the workout (energy/focus), during the workout (performance/ergogenic), and even after the workout (recovery). using animal spiked aminos may help support optimal exercise performance, hydration and immune health.https://redsupps.co.uk/products/animal-spiked-aminoshttps://cdn.shopify.com/s/files/1/2544/1734/products/Animal_Spiked_Aminos_i39035_d1200x1200_600x600_crop_center.png?v=1542781451Universal Nutrition new 1564322070579in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsEnergised BCAA 22.00GBP shopify_1564322070579_15379049545779Animal spiked aminos Animal spiked aminosaminos today are like what creatine was when it first hit the market. today, both are proven staples in the arsenals of all serious, dedicated weightlifters who are looking to make gains day in and day out. animal's newest product, spiked aminos, uses the highest quality free form and instantized bcaas and eaas. this perfectly balanced ratio of aminos are more readily absorbed and utilized than regular, conventional aminos. you can use animal spiked aminos any time during the day when you need a boost. as a training supplement, animal spiked aminos can help before the workout (energy/focus), during the workout (performance/ergogenic), and even after the workout (recovery). using animal spiked aminos may help support optimal exercise performance, hydration and immune health.https://redsupps.co.uk/products/animal-spiked-aminoshttps://cdn.shopify.com/s/files/1/2544/1734/products/Animal_Spiked_Aminos_i39035_d1200x1200_600x600_crop_center.png?v=1542781451Universal Nutrition new 1564322070579in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsEnergised BCAA 22.00GBP shopify_1484199821363_13366763225139Animal stak detailsthe hormonal edge is what separates the lifting elite from the rest of the gym culture. testosterone and growth hormone (gh) production, and aromatase regulation, are crucial in an iron athlete’s ability to grow new muscle, and to add size and strength. hence, the popularity of steroids and performance-enhancing drugs in elite athletics. instead of turning to using illicit compounds to augment their internal anabolic environment, many serious lifters have sought healthier, natural methods for raising their game.it is with this goal in mind that animal developed stak, more than a decade ago. a legacy built in the trenches for delivering an anabolic and androgenic advantage through safer, legal means, the animal stak formula is constantly being updated. providing the most cutting-edge, no-nonsense anabolic hormone boosting nutrients to bodybuilders and powerlifters who will settle for nothing less. the goal is to get bigger and stronger. to enhance performance. but to do it by optimizing a lifter’s internal hormone synthesis naturally.loaded with potent herbs, vitamins, minerals, amino acids and powerful patented compounds, each pre-dosed pack of animal stak is designed to naturally enhance the testosterone and growth hormone output of hard-training bodybuilders, all the while minimizing the production of estrogen and cortisol—the gain-killing hormones. stak even includes substrates designed to restore endocrine health and amplify endogenous hormonal output. stak seeks to naturally boost the anabolic hormones linked to power and mass, but to do so without shady ingredients and gray-market compounds.built on a legacy with roots more than a decade deep, the latest version of animal stak borrows the most powerful ingredients of its predecessors, combined with new school nutrients intended to crank it all up to the next level. more than just a testosterone booster, a hgh production catalyst or an anti-aromatase, the sum of animal stak is greater than just its individual parts. it is all of these, and then some. animal stak is extreme and all-encompassing, just like every other pack in the storied animal line.for those who constantly seek an edge, and a means to push past their limits, there is animal stak—powerful and complete, all-around, natural anabolic hormone support.https://redsupps.co.uk/products/animal-stakhttps://cdn.shopify.com/s/files/1/2544/1734/products/Animal_Stak_i476_d1200x1200_600x600_crop_center.png?v=1542781460Universal Nutrition new 1484199821363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsNatural Anabolic 35.99GBP shopify_1564361162803_15379577372723Animal test animal testtestosterone is the name of the game when it comes to adding muscular size and strength. and targeting this powerhouse male hormone for optimal natural output was the motivation behind the formulation of animal test. test is a powerful and legal hypertrophic, pro-testosterone supplement that combines potent natural compounds with a patented, proven ingredient as its core. if you’re looking to take it to the next level in your training and your strength goals, then consider what animal test can bring to the table. when part of your overall arsenal, multi-faceted animal test can help you achieve gains more effectively and efficiently.the pro-androgen complex in animal text couples natural extracts designed to facilitate a rise in both free and total testosterone with effective anti-estrogen ingredients capable of maximizing the natural anabolic response. for instance, the free test potentiator, 3-4 divanillyl tetrahydrofuran, is extracted from stinging nettle. it’s known to inhibit sex hormone binding globulin (shbg). in proven dosages, divanillyl allows for the enhanced activation of free testosterone that promotes gains in strength and size as well as improved focus, recovery and gym performance. why worry about free testosterone? total testosterone is not the name of the game here. if it’s bound, it’s unusable. that’s why the key lies in free testosterone.animal test is also loaded with anabolic ketosterones extracted from cissus quadrangularis—another effective ingredient. these ketosterones have been revered for helping to promote anabolism, boost recovery and stave off the production of catabolic stress hormones. beyond these obvious muscle and strength building properties, cissus has also been touted as a potent antioxidant capable of improving joint and ligament health, a side benefit worth noting for individuals making dramatic gains in size and strength over a short period of time.in order to capitalize on the blast of utilizable testosterone provided by these pro-androgen ingredients, animal test comes fully equipped with a combination of cutting edge anti-estrogens. first among these is the ultra antioxidant trans resveratrol (trans-3,5,4’-trihydroxystilbene). trans-resveratrol can effectively acts like a 'shield'. this compound can bind to the estrogen receptor and block circulating estrogen hormones from ever hitting the target receptor – inhibiting unwanted estrogens from reaching the hormone receptor.trans resveratrol is fortified by hearty dosages of other proven anti-estrogens, namely hesperetin (3’,5,7-trihydroxy-4’-methoxyflavone) and agaricus bisporus polysaccharides. these polysaccharides have been shown to act upon the aromatase enzyme via multiple pathways so as to help cripple any estrogenic response to a new abundance of free circulating testosterone. hesperetin has been theorized to work by inhibiting the aromatase enzyme, thus reducing excess testosterone to estrogen conversion and allowing more of the desired testosterone to be available for the receptors.in summary, these constituents work to block circulating estrogen from reaching receptors as well as negating the inevitable estrogen boost brought about by excessive testosterone production, thus directly and indirectly promoting a higher ratio of circulating serum testosterone. both components of the pro-androgen complex are assured for utmost efficiency and uptake through the inclusion of 6’,7’-dihydroxybergamottin and patented bioperine—the very best absorption-enhancing ingredients available today.the final and most powerful element of animal test is the highly heralded, proven, and patented hypertrophic agent, arachidonic acid (aa). aa is an essential fatty acid that sits at the very core of the body’s physiological response to weight training. backed by university research and real world use, arachidonic acid has multiple benefits for the hard training bodybuilder, the most dramatic of which are the ability for it to enhance androgen receptor sensitivity and to amplify training related muscle inflammation and in turn magnify hypertrophy.when lifting weights, muscle fibers are damaged and aa is released. its release alters local chemistry, which causes a shift that favors anabolism. the general anabolic cascade begins with the release of aa and is greatly amplified in the presence of higher levels of aa. higher levels translate into more androgen receptors (increasing testosterone sensitivity), heightened igf-1 signaling, greater vasodilation and even enhanced lipolysis. the availability of aa appears to dictate how strongly this anabolic cascade will be stimulated with training. in short, the more aa you have in your muscle tissue, the easier it is to trigger new growth.combining patented, cutting edge compounds with proven ingredients, animal test is far and away the most powerful product in the animal line. not for the faint of heart, animal test is the answer for the dyed in the wool power athlete looking to make explosive gains by natural means. animal test redefines the capabilities of over-the-counter bodybuilding supplementation, targeting endogenous testosterone output and hypertrophy through various means, to get you growing like never before.https://redsupps.co.uk/products/animal-testhttps://cdn.shopify.com/s/files/1/2544/1734/products/Animal_Test_i2561_d1200x1200_600x600_crop_center.png?v=1542781471Universal Nutrition new 1564361162803in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsHypertrophic Test Stack 64.99GBP shopify_1564370960435_15379703660595Animal whey 4 lbs animal wheyit is a fact we know well. there is no more critical staple in the supplement regimen of a serious weight trainer than protein powder. as it is a perfect means of filling the gaps bridging whole-food meals, providing a concentrated dose of the most important macronutrient for bodybuilding—protein. just about every serious bodybuilder uses whey protein regularly--in the am, between meals, postworkout, mixed in their oatmeal, before bed. with such a valuable and flexible muscle-building commodity, the possibilities are endless. so as such, were animal to make a foray into that highly competitive category, we had to do it right... we had to come prepared to win. the best animal protein would have to meet and exceed the demands of the most demanding lifters in terms of mixabilty, digestibility and flavor.it was with these high standards in mind that we formulated animal whey. rich in prized whey protein isolate, fortified by digestive enzymes, mixes easily. a whopping 25 grams of protein per scoop. and it tastes great. we endeavored to create the ideal bodybuilding protein source, one worthy of the thirty-plus year animal legacy, and the accolades garnered in the trenches assure us that this enterprise was a success. never ones to settle, however, we continue to push for excellence.always adding to our already wide range of outrageous flavors, animal whey stands apart from the crowd not just in terms of quality, but in taste. because after all, if you’re going to drink multiple protein shakes per day in order to meet your nutritional requirements, it better taste awesome. and it does. providing standards like chocolate and vanilla for the traditional types, and more unique offerings like brownie batter, salted caramel and chocolate mint for lifters who dig something decadent in their shaker cup.with animal whey we held nothing back. we simply set our minds on delivering the best quality whey protein powder available to an audience of diehard lifters who will accept nothing less. no games. no tricks. no hype. just protein done right.https://redsupps.co.uk/products/animal-wheyhttps://cdn.shopify.com/s/files/1/2544/1734/products/ANIMAL-WHEY-4LBS-banana_2000x_3e13c7a6-5b3b-48e1-872a-5a274d0ff296_600x600_crop_center.jpg?v=1542781475Universal Nutrition new 1564370960435in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Isolate 48.99GBP shopify_1564370960435_15379703726131Animal whey 4 lbs animal wheyit is a fact we know well. there is no more critical staple in the supplement regimen of a serious weight trainer than protein powder. as it is a perfect means of filling the gaps bridging whole-food meals, providing a concentrated dose of the most important macronutrient for bodybuilding—protein. just about every serious bodybuilder uses whey protein regularly--in the am, between meals, postworkout, mixed in their oatmeal, before bed. with such a valuable and flexible muscle-building commodity, the possibilities are endless. so as such, were animal to make a foray into that highly competitive category, we had to do it right... we had to come prepared to win. the best animal protein would have to meet and exceed the demands of the most demanding lifters in terms of mixabilty, digestibility and flavor.it was with these high standards in mind that we formulated animal whey. rich in prized whey protein isolate, fortified by digestive enzymes, mixes easily. a whopping 25 grams of protein per scoop. and it tastes great. we endeavored to create the ideal bodybuilding protein source, one worthy of the thirty-plus year animal legacy, and the accolades garnered in the trenches assure us that this enterprise was a success. never ones to settle, however, we continue to push for excellence.always adding to our already wide range of outrageous flavors, animal whey stands apart from the crowd not just in terms of quality, but in taste. because after all, if you’re going to drink multiple protein shakes per day in order to meet your nutritional requirements, it better taste awesome. and it does. providing standards like chocolate and vanilla for the traditional types, and more unique offerings like brownie batter, salted caramel and chocolate mint for lifters who dig something decadent in their shaker cup.with animal whey we held nothing back. we simply set our minds on delivering the best quality whey protein powder available to an audience of diehard lifters who will accept nothing less. no games. no tricks. no hype. just protein done right.https://redsupps.co.uk/products/animal-wheyhttps://cdn.shopify.com/s/files/1/2544/1734/products/ANIMAL-WHEY-4LBS-banana_2000x_3e13c7a6-5b3b-48e1-872a-5a274d0ff296_600x600_crop_center.jpg?v=1542781475Universal Nutrition new 1564370960435in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Isolate 48.99GBP shopify_1564370960435_15379703758899Animal whey 4 lbs animal wheyit is a fact we know well. there is no more critical staple in the supplement regimen of a serious weight trainer than protein powder. as it is a perfect means of filling the gaps bridging whole-food meals, providing a concentrated dose of the most important macronutrient for bodybuilding—protein. just about every serious bodybuilder uses whey protein regularly--in the am, between meals, postworkout, mixed in their oatmeal, before bed. with such a valuable and flexible muscle-building commodity, the possibilities are endless. so as such, were animal to make a foray into that highly competitive category, we had to do it right... we had to come prepared to win. the best animal protein would have to meet and exceed the demands of the most demanding lifters in terms of mixabilty, digestibility and flavor.it was with these high standards in mind that we formulated animal whey. rich in prized whey protein isolate, fortified by digestive enzymes, mixes easily. a whopping 25 grams of protein per scoop. and it tastes great. we endeavored to create the ideal bodybuilding protein source, one worthy of the thirty-plus year animal legacy, and the accolades garnered in the trenches assure us that this enterprise was a success. never ones to settle, however, we continue to push for excellence.always adding to our already wide range of outrageous flavors, animal whey stands apart from the crowd not just in terms of quality, but in taste. because after all, if you’re going to drink multiple protein shakes per day in order to meet your nutritional requirements, it better taste awesome. and it does. providing standards like chocolate and vanilla for the traditional types, and more unique offerings like brownie batter, salted caramel and chocolate mint for lifters who dig something decadent in their shaker cup.with animal whey we held nothing back. we simply set our minds on delivering the best quality whey protein powder available to an audience of diehard lifters who will accept nothing less. no games. no tricks. no hype. just protein done right.https://redsupps.co.uk/products/animal-wheyhttps://cdn.shopify.com/s/files/1/2544/1734/products/ANIMAL-WHEY-4LBS-banana_2000x_3e13c7a6-5b3b-48e1-872a-5a274d0ff296_600x600_crop_center.jpg?v=1542781475Universal Nutrition new 1564370960435in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Isolate 48.99GBP shopify_1564370960435_15379703791667Animal whey 4 lbs animal wheyit is a fact we know well. there is no more critical staple in the supplement regimen of a serious weight trainer than protein powder. as it is a perfect means of filling the gaps bridging whole-food meals, providing a concentrated dose of the most important macronutrient for bodybuilding—protein. just about every serious bodybuilder uses whey protein regularly--in the am, between meals, postworkout, mixed in their oatmeal, before bed. with such a valuable and flexible muscle-building commodity, the possibilities are endless. so as such, were animal to make a foray into that highly competitive category, we had to do it right... we had to come prepared to win. the best animal protein would have to meet and exceed the demands of the most demanding lifters in terms of mixabilty, digestibility and flavor.it was with these high standards in mind that we formulated animal whey. rich in prized whey protein isolate, fortified by digestive enzymes, mixes easily. a whopping 25 grams of protein per scoop. and it tastes great. we endeavored to create the ideal bodybuilding protein source, one worthy of the thirty-plus year animal legacy, and the accolades garnered in the trenches assure us that this enterprise was a success. never ones to settle, however, we continue to push for excellence.always adding to our already wide range of outrageous flavors, animal whey stands apart from the crowd not just in terms of quality, but in taste. because after all, if you’re going to drink multiple protein shakes per day in order to meet your nutritional requirements, it better taste awesome. and it does. providing standards like chocolate and vanilla for the traditional types, and more unique offerings like brownie batter, salted caramel and chocolate mint for lifters who dig something decadent in their shaker cup.with animal whey we held nothing back. we simply set our minds on delivering the best quality whey protein powder available to an audience of diehard lifters who will accept nothing less. no games. no tricks. no hype. just protein done right.https://redsupps.co.uk/products/animal-wheyhttps://cdn.shopify.com/s/files/1/2544/1734/products/ANIMAL-WHEY-4LBS-banana_2000x_3e13c7a6-5b3b-48e1-872a-5a274d0ff296_600x600_crop_center.jpg?v=1542781475Universal Nutrition new 1564370960435in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Isolate 48.99GBP shopify_1564370960435_15379703824435Animal whey 4 lbs animal wheyit is a fact we know well. there is no more critical staple in the supplement regimen of a serious weight trainer than protein powder. as it is a perfect means of filling the gaps bridging whole-food meals, providing a concentrated dose of the most important macronutrient for bodybuilding—protein. just about every serious bodybuilder uses whey protein regularly--in the am, between meals, postworkout, mixed in their oatmeal, before bed. with such a valuable and flexible muscle-building commodity, the possibilities are endless. so as such, were animal to make a foray into that highly competitive category, we had to do it right... we had to come prepared to win. the best animal protein would have to meet and exceed the demands of the most demanding lifters in terms of mixabilty, digestibility and flavor.it was with these high standards in mind that we formulated animal whey. rich in prized whey protein isolate, fortified by digestive enzymes, mixes easily. a whopping 25 grams of protein per scoop. and it tastes great. we endeavored to create the ideal bodybuilding protein source, one worthy of the thirty-plus year animal legacy, and the accolades garnered in the trenches assure us that this enterprise was a success. never ones to settle, however, we continue to push for excellence.always adding to our already wide range of outrageous flavors, animal whey stands apart from the crowd not just in terms of quality, but in taste. because after all, if you’re going to drink multiple protein shakes per day in order to meet your nutritional requirements, it better taste awesome. and it does. providing standards like chocolate and vanilla for the traditional types, and more unique offerings like brownie batter, salted caramel and chocolate mint for lifters who dig something decadent in their shaker cup.with animal whey we held nothing back. we simply set our minds on delivering the best quality whey protein powder available to an audience of diehard lifters who will accept nothing less. no games. no tricks. no hype. just protein done right.https://redsupps.co.uk/products/animal-wheyhttps://cdn.shopify.com/s/files/1/2544/1734/products/ANIMAL-WHEY-4LBS-banana_2000x_3e13c7a6-5b3b-48e1-872a-5a274d0ff296_600x600_crop_center.jpg?v=1542781475Universal Nutrition new 1564370960435in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Isolate 48.99GBP shopify_369643716645_5020634775589Anogenin benefitsincreases strengthsafe for women descriptionevery hard-training athlete wants to make gains in the performance and physique, but not every athlete wants to jump head first into the world of anabolics, where the rewards are monumental, but so are the risks. blackstone labs realizes that all athletes want to build muscle and increase performance and have created the ultimate all-natural muscle building supplement in anogenin.anogenin is a non-hormonal muscle builder to enhance strength, recovery, and lean muscle mass as well as decrease body fat levels. anogenin is perfect for men and women as it won’t affect your hormone levels, but will significantly enhance your performance and physique. ingredients5 alpha hydroxy laxogenin (25mg) commonly referred to as laxogenin or “laxo” for short, 5 alpha hydroxy laxogenin is an all-natural, plant-based steroid shown to enhance protein synthesis by over 200%! anogenin doesn’t affect natural testosterone production (meaning there’s no need for post cycle therapy), but will significantly increase strength, power, performance, and body composition in as little as 2-3 weeks! natty or not, anogenin belongs in any muscle-building stack. directionsas a dietary supplement, take one (1) capsule two (2) times per day with food. do not take more than two (2) capsules per day. use in cycles of 8-12 weeks, taking at least 4 weeks off between cycle. this product does not require a pct.https://redsupps.co.uk/products/blackstone-labs-anogenin-60caps-anabolic-activator-natural-lean-muscle-gainshttps://cdn.shopify.com/s/files/1/2544/1734/products/anogenin_600x600_crop_center.png?v=1542781477Blackstone Labs new 369643716645in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Builder 39.99GBP shopify_369643356197_4714190143525Apex male benefitsnatural test boosterincreases sexual health descriptionbeginning at age 30, men experience a gradual, and consistent, decline in testosterone production. declining testosterone levels means it’s harder to build muscle, and a whole lot easier to gain fat. until now, the aging male faced two choices, neither ideal -- suffer the incessant drop in testosterone, or embrace testosterone replacement therapy.blackstone labs has developed a third option, one that restores optimal testosterone production without resorting to chemicals, pharmaceuticals, patches, or injections. apex male is a revolutionary, all-natural testosterone booster any man can use to restore health, vigor, and vitality. it’s the daily staple all men over 30 need to boost testosterone production and bring out the alpha male. ingredientsd-aspartic acid (1500mg) daa is an amino acid documented to enhance gonadotropin releasing hormone as well as growth hormone (gh) and luteinizing hormone (lh). additional research on this muscle-building amino shows it can directly increase testosterone production by the testesbulbine natalensis (500mg) long used as an aphrodisiac by ancient peoples, bulbine has some incredible research showing it can increase serum testosterone levels, follicle-stimulating hormone (fsh), luteinizing hormone (lh), and even testicle size! what’s more, bulbine has also been shown to reduce estrogen levels in the body, creating the ultimate anabolic environment in your body.fenugreek extract (125mg) is extremely well known in the ayurveda and has been used as a tonic to aid everything from fever to diabetes. it’s also a proven testosterone boosting ingredient too! fenugreek is believed to inhibit aromatase activity, thereby enhancing testosterone levels and while also decreasing body fat.tribulus terrestris (125mg) is another incredibly popular and well-researched ayurvedic herb used to enhance male virility/vitality. research shows that tribulus can increase igf-1 and testosterone and enhance lean body mass, while also reducing body fat.maca extract (125mg) potent botanical traditionally used by peruvian men to enhance performance and stamina. modern research shows that maca can indeed boost libido, sexual desire, and fertility.l-tyrosine (125mg) a nonessential amino acid the body uses to produce the important neurotransmitter dopamine. in addition to enhancing mood, increased dopamine production also kickstarts a series of physiological processes culminating in greater natural testosterone production. suffice it to say this is one nonessential amino that is absolutely essential to optimal testosterone levels!dim (100mg) short for diindolylmethane, dim is a powerful anti-estrogen compound present in cruciferous vegetables, such as broccoli or cauliflower. dim supports hormonal homeostasis in the body by increasing more of the “good” estrogens and decreasing the “bad” estrogens.prunella vulgaris (75mg) commonly used chinese herb, that’s also known as self-heal. prunella vulgaris is edible and typically consumed in salads or brewed as a tea. it’s also a powerful antiestrogenic ingredient that reduce estrogen levels through activation of the ahr (aryl hydrocarbon receptor) receptor.epimedium extract (75mg) more commonly known as “horny goat weed”, epimedium is a plant found across asia and the mediterranean traditionally used as an aphrodisiac. it’s rich in a compound called icariin which blocks the activity of a pde5, an enzyme that interferes with nitric oxide production. supplementing with icariin can enhance no delivery and blood flow to sexual organs, enhancing performance and stamina.n-methyl d-aspartate (15mg) derivative of d-aspartic acid shown to be 100x more potent than regular daa. as a more potent, and more water-soluble form of daa, nmda should trigger substantial muscle growth and testosterone production at a fraction of the required daa dose.bioperine (5mg) patented form of piperine, a black pepper extract included to enhance the bioavailability and utilization of all the testosterone-boosting compounds in apex male, ensuring you get maximum effectiveness from every dose.vitamin d3 (1250iu) plays a critical role in testosterone production and overall health. research shows that men deficient in this essential vitamin have higher body fat and estrogen levels along with lower lean mass and reduced fertility. directionsas a dietary supplement, take four (4) capsules two (2) times per day with food. apex male is a complete and natural test booster, and requires no cycling or pct. store in a cool, dry place.https://redsupps.co.uk/products/blackstone-labs-apex-male-240caps-great-test-booster-huge-gains-complete-pcthttps://cdn.shopify.com/s/files/1/2544/1734/products/apexmale_790e9d36-64c9-448d-9bd9-6af409095023_600x600_crop_center.png?v=1542781493Blackstone Labs new 369643356197in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsTestosterone Boosters 42.99GBP shopify_1423292629043_12867887595571Apple cider vinegar 946 ml benefitscontains the "mother"apple cider vinegar diluted to 5% acidityunpasteurizednaturally gluten freemade from organic apples descriptionbragg organic apple cider vinegar is made from delicious, healthy, organically grown apples and is the wholesome way to add delicious flavour to most foods. unfiltered, unheated and unpasteurized, bragg apple cider vinegar has just 5% acidity and is full of zesty natural goodness.bragg organic apple cider vinegar contains the amazing 'mother of vinegar' which occurs naturally as strand-like enzymes of connected protein molecules. it is processed and bottled in accordance with usda guidelines. ingredientscertified organic raw apple cider vinegar and purified water, diluted to 5% acidityhttps://redsupps.co.uk/products/apple-cider-vinegar-946-mlhttps://cdn.shopify.com/s/files/1/2544/1734/products/26368_600x600_crop_center.jpg?v=1542781497Bragg new 1423292629043in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsApple Cider Vinegar 9.99GBP shopify_1638346194995_15892182368307Ar1macare pro key benefits of ar1macare prohealthy liver supporthealthy levels of estrogenhealthy levels of prolactinhealthy cardiovascular function (blood pressure/blood lipids)healthy levels of cortisol overall health & estrogen managementmaintain your most important biomarkerssummon superhuman protection for your demigod-like gains!are you about to start a prohormone cycle and transform into a superhero?then you’re likely aware that with great power comes great responsibility......i.e., you must defend yourself from the sneaky supervillains of prohormone cycles: high blood pressure, altered blood lipids, liver stress, and estrogen.otherwise your superhero physique will remain out of reach. even the strongest superheroes had weaknesses.now you can guard yourself against all the physique-derailing supervillains with the first (and only) fully-loaded cycle support and estrogen blocker in one with ar1macare pro!14 fully dosed ingredients make ar1macare pro an unparalleled on-cycle support stack.leave it to the team at olympus labs to produce a protective elixir that allows you to focus on your gains without being derailed by bad blood work or compromised health status.https://redsupps.co.uk/products/ar1macare-prohttps://cdn.shopify.com/s/files/1/2544/1734/products/Ar1macarePro_2048x_87a05411-f29e-44aa-b2ba-f6668ec7312c_600x600_crop_center.png?v=1544869018Olympus Labs new 1638346194995in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCycle Support 39.99GBP shopify_1565029105715_15386230063155Ashwagandha 450 mg Ashwagandha 450 mgashwagandha (withania somnifera) is an herb that is extensively used in ayurveda, the traditional herbal system in india. ashwagandha is used as a general tonic and "adaptogen," helping the body adapt to temporary, normal stress. in addition, preliminary data suggest that ashwagandha supports a healthy immune system.suggested usetake 1 capsule 2 to 3 times daily.https://redsupps.co.uk/products/ashwagandha-450-mghttps://cdn.shopify.com/s/files/1/2544/1734/products/now_ash_600x600_crop_center.jpg?v=1542781517NOW FOODS new 1565029105715in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAdaptogen 20.99GBP shopify_1638406160435_15892394082355Assass1nate silently assassinate your fat like ninjanon-stimulant fat burner & glucose disposal agentnutrient repartitioning propertiesinnovative & unique ingredientsassassinate fat while partitioning carbsaspiring demigods and demigoddesses are continuously working to tr1umph over mediocrity to achieve the ultimate physique. a part of that process requires periods when you need to shift your focus to fat loss. the dreaded dieting phase where you reduce calories, usually in the form of carbs to get shredded. a lower calorie diet will reduce energy levels so you increase intake of stimulants. sound familiar? there has to be a better way!it would be nice if there was a supplement that helped you lose weight without starving yourself to induce weight loss and subsequently depending on stimulants to remain functional. thankfully, there is a supplement company that has the foresight to attempt such a feat. olympus labs is proud to present assass1nate, a combined stimulant free fat burner and glucose disposal agent (gda) supplement.olympus labs considers the customer’s needs before profits and utilizes the best minds in the business to formulate supplements. the end result is innovative and effective products that are worth your hard earned money. assass1nate is no exception as it achieves everything you would expect in a fat burner plus additional benefits you never would think were possible. assass1nate allows you to conqu3r dieting with the following two potent matrices.the metabolism stimulation & extreme thermogenic activation with 630mg dihydromyricetin, 25mg trans-tiliroside and 100mg carnosic acid will ignit3 the thermogenic furnace to start melting the pounds away.sound too good to be true? perhaps you need to raise your expectations on the quality of the supplements you purchase. olympus labs care about quality, from the selection of the ingredients in our supplements to the sourcing and testing of said ingredients. that is precisely why olympus labs supplements deliver results! we are extremely confident assass1nate will continue that trend. a potent stimulant free fat burner and gda in one. the supplement that you never even thought of, but need to have!dihydromyricetin 700mgimproves both glucose and lipid metabolism and exerts anti-inflammatory effects. it alleviates insulin resistance and enhances glucose uptake.trans-tiliroside 500mgtrans-tiliroside, extracted from plants such as rose hips, boosts ampk activation. among its many benefits, a human-equivalent dosage as low as 56 mg daily has been shown by researchers in preclinical studies to promote healthy blood glucose levels and body weight already within normal range.carnosic acid (20%) 500mgcarnosic acid (ca), an extract of rosemary, shows body-weight, energy metabolism, and inflammation-regulatory properties in animal models.orthosiphon stamineus (70% ethanolic extract) 300mgincreases glucose uptake into muscle tissue in a complementary manner to insulin. acutely reduces blood glucose via ampk.olive leaf extract (20% hyroxytyrosol) 150mghydroxytyrosol is one of the main phenolic components of olive oil. it exerts protective effects on glucose metabolism. hydroxytyrosol generally enhances pancreatic β-cell function (and therefore, insulin secretion in response to carbohydrate).lutein 20% 125mgactivates carnitine palmitoyltransferase-1 (cpt-1), an essential step in the beta-oxidation of long chain fatty acids, stimulating fat metabolism.oleoylethanolamide 200mgoleoylethanolamine is an endogenous peroxisome proliferator-activated receptor alpha (ppar-α) agonist that works to regulate—in this case, lower—appetite and stimulate fatty acid metabolism.directions: take 2 capsules twice daily before your larger carb meals of the day, or take 4 capsules once daily before your largest carb meal of the day.https://redsupps.co.uk/products/assass1natehttps://cdn.shopify.com/s/files/1/2544/1734/products/Assass1nate_2048x_877198c6-f446-454e-a423-2ec5cd33fd3b_600x600_crop_center.png?v=1544876020Olympus Labs new 1638406160435in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsNon Stimulant Fat Burner 37.99GBP shopify_1613618085939_15641965363251Azoth 2.0 key featuresthe strongest all in one productivity nootropic on the market. designed to increase focus, energy, and crush any rises in stress, anxiety, and depression in its tracks without a crash or a tolerance build-up with just 1-3 capsules a day. no extra products required. no caffeine. no jitters. no withdrawals. no headaches. ingredients up to 5-10x of competition. no proprietary blend. fully compliant, fully-disclosed label. compare our label to alpha brain, neuropeak or ciltep and we crush them all day, every day.infused with cortisol blockers and adaptogens. supports adrenal glands after years of caffeine/stimulant abuse and supports a healthy mood and a reduction of anxiety and depression-like symptoms. 100% made in the usa. support us manufacturing.  by purchasing our product, you are supporting us-made manufacturing. every part of the production from labeling, to  distribution, to manufacturing is completed in the usa. we don't  outsource anything. ​ descriptionwhat is azoth 2.0?azoth 2.0 is dietary supplement that may optimize mood, boost levels of confidence and motivation, and decrease rises in stress, depression, and anxiety. ​what are the benefits of azoth 2.0?increases body's own natural energy productiondoesn't cause any tolerance buildupdesigned to not cause any crashes or headaches lasts 6-8 hours clinically dosed, no proprietary blend and mg by mg the most effective nootropic on the market.usa made, batch tested. ​how does azoth 2.0 work?azoth 2.0 increases signal transmission in the brain and boosts levels of dopamine and serotonin (the chemicals responsible for motivation and mood) to their natural levels.​is azoth 2.0 a energy product?azoth 2.0 is not a traditional energy booster. azoth 2.0 increases your body's own natural energy production instead of temporarily stimulating (and then crashing) your body's reward chemicals. azoth 2.0 brings your dopamine and serotonin back to where they should naturally be. as such, you will feel a level of controlled alertness and optimism often felt after a restful night's sleep, and won't feel any crashes, headaches, or withdrawals. ​what should azoth 2.0 be used for? 1. reducing daytime fatigue 2. increasing natural energy without caffeine3. reducing caffeine dependency 4. boosting motivation after periods of apathy and loss of interest in previously enjoyable tasks5. augmenting confidence and decreasing anxiety in social situations 6. reducing levels of stress and depression​what are the ingredients in azoth 2.0?sulbutiamine (400 mg) sulbutiamine is a highly bioavailable form of vitamin b1 that facilitates the stimulation of the neurotransmitters glutamate and dopamine and increases communication between neurons in the brain. sulbutiamine can drastically increase motivation, cognitive function, and attention levels. teacrine® (100 mg)t​eacrine® is a patent-pending compound containing pure theacrine which has molecular similarities to caffeine. however, unlike caffeine, teacrine® provides energy boosting effects without the jitters, the crash and the habituation that often accompany caffeine consumption. alpha-gpc (300 mg) (50% extract)alpha-gpc is a water-soluble chemical that improves signal transmission within the brain and directly increases the synthesis and secretion of acetylcholine. raising the levels of acetylcholine causes the brain to rapidly form more connections and increases the speed at which the brain can process new and existing information.   ​huperzine a (1%) (10 mcg)huperzine a incites neurons to make new connections at an extremely rapid rate, thus accelerating learning speed and capacity to superhuman levels.l-tyrosine (500 mg)l-tyrosine increases brain neurotransmitter concentrations and suppresses rises in cortisol and norepinephrine depletion. this has the effect of severely reducing stress during times of high-pressure, increasing reaction time, and augmenting awareness and cognition during periods of intense sleep or nutrient deprivation.hordenine hcl (50 mg)hordenine creates a hormonally balanced neurological environment with excellent alertness, very fast response time to stimulus, and the mental acuity to focus upon work for long stretches of time without drifting into a fog. ​ashwagandha root (500 mg) as a powerful anti-oxidant, ashwagandha promotes immune protection and is used to significantly reduce performance anxiety before major life events.  bioperine™ (10 mg) bioperine is the only product sourced out of piperine to obtain a patented status for its ability to increase the bioavailability of nutritional compounds. taking bioperine increases the likelihood that the ingredients you are ingesting are actually being absorbed by your body. ​​*** none of these statements have been evaluated by the fda. this supplement is not intended to cure or prevent any disease or medical conditions. https://redsupps.co.uk/products/azoth-2-0https://cdn.shopify.com/s/files/1/2544/1734/products/IMG_4777_600x600_crop_center.jpeg?v=1543492917AZOTH new 1613618085939in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsNootropic Formula 34.99GBP shopify_1565017669683_15386152730675B-6 100 mg B-6 100 mgsupports healthy homocysteine metabolism*important for nervous system function*vitamin b-6 is a cofactor in numerous enzymatic reactions and is required for the metabolism of fats, carbohydrates, and proteins.* it facilitates the conversion of amino acids from one to another as needed, and is necessary for normal synthesis of hemoglobin, as well as for normal function and production of red blood cells.* b-6 plays an important role in regulating homocysteine metabolism in the body.* homocysteine, a by-product of the methionine cycle, is known to be destructive to bodily tissues, especially vascular structures. b-6 is also critical for the maintenance of a healthy nervous system.*https://redsupps.co.uk/products/b-6-100-mghttps://cdn.shopify.com/s/files/1/2544/1734/products/now_b6_600x600_crop_center.jpg?v=1541617220NOW FOODS new 1565017669683in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsEssential Vitamin 12.99GBP shopify_691176046643_8412844195891Basic pct stack stacks automatically discounted 10% or morewhat's included?eradicategear supportpctvhttps://redsupps.co.uk/products/basic-pct-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/pct-stack-basic_1024x_1c517744-7660-4009-a872-dd0bb3b37ecd_600x600_crop_center.png?v=1541617245Blackstone Labs new 691176046643in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsBasic PCT Stack 94.99GBP shopify_369644797989_4714193158181Bcaa resurgence benefitsall day supplementationpacked with amino acids descriptionwhen you’re primary concern is building muscle, there’s a few things you need to focus on each day -- eating ample calories, training intensely by following the principles of progressive overload, resting enough. but sometimes that’s not enough. sometimes your body is missing those key nutrients it needs throughout the day to repair, replenish and rebuild your mind and muscles.resurgence is your all day, every day muscle-building insurance policy that provides the essential amino acids, vitamins, and minerals to promote optimal muscle growth and recovery. also included is a powerful focus matrix including proven nootropics to obliterate mental fatigue and promote long-lasting focus and concentration all day long.say goodbye to soreness, achiness, lethargy, and lackluster gains once and for all with resurgence! ingredientshica scientifically known as alpha-hydroxy-isocaproic-acid, or leucic acid, hica is a metabolite of the leucine that works in conjunction with other active amino acids present in resurgence to stimulate muscle growth and accelerate recovery.theobrominea relative of caffeine, theobromine is a xanthine-like molecule that stimulates the cns similar to caffeine but energy surge is much smoother and longer-lasting. additionally, theobromine also enhances vasodilation, promoting superior cerebral blood flow for greater focus and concentration.cdp-choline choline is an essential nutrient that plays a critical role in gene expression, cell membrane signaling, lipid transport, metabolism, and brain development. cdp-choline is a highly bioavailable form of supplemental choline that increases synthesis of acetylcholine (a.k.a. “the learning neurotransmitter). higher levels of acetylcholine promote greater focus, concentration, and the ever-important mind-muscle connection during exercise.l-leucine (2g) dubbed the “king” of all amino acids, leucine is one of the three branched-chain amino acids, along with isoleucine and valine, that plays a key role in muscle growth. leucine is the primary stimulator of muscle protein synthesis by activating the mtor pathway which flips the switch in your body to build muscle.l-isoleucine (1g) another one of the bcaas that can stimulate muscle protein synthesis, but to a lesser extent than leucine. however, isoleucine does play a significant role in glucose uptake and utilization during exercise, resulting in greater energy production and performance. isoleucine may also play a role in fat loss, as some research indicates the amino acid inhibits fat storage and increases fat burning.l-valine (1g) the third bcaa, valine supports greater endurance and reduced fatigue while training. valine competes with tryptophan (another amino acid) for uptake into the brain (and wins!), leading to decreased serotonin production. the brain interprets serotonin as an indicator of fatigue, so with less serotonin, you’ll be able to push harder for longer during your lifting sessions.l-lysine (1mg) supports the production of carnitine, a compound that helps convert fatty acids into useable energy. lysine also enhances calcium absorption, and works in conjunction with l-arginine to increase growth hormone (gh) production.l-taurine (1g) a conditionally essential amino acid, taurine exerts a number of beneficial effects in the body. taurine enhances cellular hydration, promoting greater endurance and stamina, and also improves mood and focus due to large concentrations of the amino being present in the brain.threonine (950mg) supports optimal functioning of the cardiovascular, liver, central nervous, and immune systems of the body. research notes that threonine also helps maintain the protein balance in the body and accelerate recovery from an injury.l-alanine (500mg) plays a crucial role in protein synthesis, even though it’s classified as a nonessential amino acid. additionally, alanine can also convert to pyruvate, a compound essential for glucose production and blood sugar regulation.methionine (300mg) vital to the production of creatine and carnitine in the body. as a result, this essential amino acid aids energy production, athletic performance, cellular hydration, and most importantly, lean mass gains..phenylalanine (150mg) as a precursor to tyrosine, phenylalanine increases production of three key neurotransmitters -- dopamine, epinephrine, and adrenaline. these three neurotransmitters enhance alertness and mood, and serve a critical role in muscle activation. instructionsfor an amino acid boost, take one (1) scoop first thing in the morning.for pre-workout energy, take one (1) to two (2) scoops 30 minutes before training.for post-workout recovery, take one (1) to two (2) scoops immediately after training.https://redsupps.co.uk/products/blackstone-labs-resurgence-bcaa-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/bcaaresurgence-pinacolada-purple_600x600_crop_center.png?v=1541617247Blackstone Labs new 369644797989in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsBCAA 29.00GBP shopify_369644797989_4714193190949Bcaa resurgence benefitsall day supplementationpacked with amino acids descriptionwhen you’re primary concern is building muscle, there’s a few things you need to focus on each day -- eating ample calories, training intensely by following the principles of progressive overload, resting enough. but sometimes that’s not enough. sometimes your body is missing those key nutrients it needs throughout the day to repair, replenish and rebuild your mind and muscles.resurgence is your all day, every day muscle-building insurance policy that provides the essential amino acids, vitamins, and minerals to promote optimal muscle growth and recovery. also included is a powerful focus matrix including proven nootropics to obliterate mental fatigue and promote long-lasting focus and concentration all day long.say goodbye to soreness, achiness, lethargy, and lackluster gains once and for all with resurgence! ingredientshica scientifically known as alpha-hydroxy-isocaproic-acid, or leucic acid, hica is a metabolite of the leucine that works in conjunction with other active amino acids present in resurgence to stimulate muscle growth and accelerate recovery.theobrominea relative of caffeine, theobromine is a xanthine-like molecule that stimulates the cns similar to caffeine but energy surge is much smoother and longer-lasting. additionally, theobromine also enhances vasodilation, promoting superior cerebral blood flow for greater focus and concentration.cdp-choline choline is an essential nutrient that plays a critical role in gene expression, cell membrane signaling, lipid transport, metabolism, and brain development. cdp-choline is a highly bioavailable form of supplemental choline that increases synthesis of acetylcholine (a.k.a. “the learning neurotransmitter). higher levels of acetylcholine promote greater focus, concentration, and the ever-important mind-muscle connection during exercise.l-leucine (2g) dubbed the “king” of all amino acids, leucine is one of the three branched-chain amino acids, along with isoleucine and valine, that plays a key role in muscle growth. leucine is the primary stimulator of muscle protein synthesis by activating the mtor pathway which flips the switch in your body to build muscle.l-isoleucine (1g) another one of the bcaas that can stimulate muscle protein synthesis, but to a lesser extent than leucine. however, isoleucine does play a significant role in glucose uptake and utilization during exercise, resulting in greater energy production and performance. isoleucine may also play a role in fat loss, as some research indicates the amino acid inhibits fat storage and increases fat burning.l-valine (1g) the third bcaa, valine supports greater endurance and reduced fatigue while training. valine competes with tryptophan (another amino acid) for uptake into the brain (and wins!), leading to decreased serotonin production. the brain interprets serotonin as an indicator of fatigue, so with less serotonin, you’ll be able to push harder for longer during your lifting sessions.l-lysine (1mg) supports the production of carnitine, a compound that helps convert fatty acids into useable energy. lysine also enhances calcium absorption, and works in conjunction with l-arginine to increase growth hormone (gh) production.l-taurine (1g) a conditionally essential amino acid, taurine exerts a number of beneficial effects in the body. taurine enhances cellular hydration, promoting greater endurance and stamina, and also improves mood and focus due to large concentrations of the amino being present in the brain.threonine (950mg) supports optimal functioning of the cardiovascular, liver, central nervous, and immune systems of the body. research notes that threonine also helps maintain the protein balance in the body and accelerate recovery from an injury.l-alanine (500mg) plays a crucial role in protein synthesis, even though it’s classified as a nonessential amino acid. additionally, alanine can also convert to pyruvate, a compound essential for glucose production and blood sugar regulation.methionine (300mg) vital to the production of creatine and carnitine in the body. as a result, this essential amino acid aids energy production, athletic performance, cellular hydration, and most importantly, lean mass gains..phenylalanine (150mg) as a precursor to tyrosine, phenylalanine increases production of three key neurotransmitters -- dopamine, epinephrine, and adrenaline. these three neurotransmitters enhance alertness and mood, and serve a critical role in muscle activation. instructionsfor an amino acid boost, take one (1) scoop first thing in the morning.for pre-workout energy, take one (1) to two (2) scoops 30 minutes before training.for post-workout recovery, take one (1) to two (2) scoops immediately after training.https://redsupps.co.uk/products/blackstone-labs-resurgence-bcaa-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/bcaaresurgence-pinacolada-purple_600x600_crop_center.png?v=1541617247Blackstone Labs new 369644797989in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsBCAA 29.00GBP shopify_369644797989_6992712138803Bcaa resurgence benefitsall day supplementationpacked with amino acids descriptionwhen you’re primary concern is building muscle, there’s a few things you need to focus on each day -- eating ample calories, training intensely by following the principles of progressive overload, resting enough. but sometimes that’s not enough. sometimes your body is missing those key nutrients it needs throughout the day to repair, replenish and rebuild your mind and muscles.resurgence is your all day, every day muscle-building insurance policy that provides the essential amino acids, vitamins, and minerals to promote optimal muscle growth and recovery. also included is a powerful focus matrix including proven nootropics to obliterate mental fatigue and promote long-lasting focus and concentration all day long.say goodbye to soreness, achiness, lethargy, and lackluster gains once and for all with resurgence! ingredientshica scientifically known as alpha-hydroxy-isocaproic-acid, or leucic acid, hica is a metabolite of the leucine that works in conjunction with other active amino acids present in resurgence to stimulate muscle growth and accelerate recovery.theobrominea relative of caffeine, theobromine is a xanthine-like molecule that stimulates the cns similar to caffeine but energy surge is much smoother and longer-lasting. additionally, theobromine also enhances vasodilation, promoting superior cerebral blood flow for greater focus and concentration.cdp-choline choline is an essential nutrient that plays a critical role in gene expression, cell membrane signaling, lipid transport, metabolism, and brain development. cdp-choline is a highly bioavailable form of supplemental choline that increases synthesis of acetylcholine (a.k.a. “the learning neurotransmitter). higher levels of acetylcholine promote greater focus, concentration, and the ever-important mind-muscle connection during exercise.l-leucine (2g) dubbed the “king” of all amino acids, leucine is one of the three branched-chain amino acids, along with isoleucine and valine, that plays a key role in muscle growth. leucine is the primary stimulator of muscle protein synthesis by activating the mtor pathway which flips the switch in your body to build muscle.l-isoleucine (1g) another one of the bcaas that can stimulate muscle protein synthesis, but to a lesser extent than leucine. however, isoleucine does play a significant role in glucose uptake and utilization during exercise, resulting in greater energy production and performance. isoleucine may also play a role in fat loss, as some research indicates the amino acid inhibits fat storage and increases fat burning.l-valine (1g) the third bcaa, valine supports greater endurance and reduced fatigue while training. valine competes with tryptophan (another amino acid) for uptake into the brain (and wins!), leading to decreased serotonin production. the brain interprets serotonin as an indicator of fatigue, so with less serotonin, you’ll be able to push harder for longer during your lifting sessions.l-lysine (1mg) supports the production of carnitine, a compound that helps convert fatty acids into useable energy. lysine also enhances calcium absorption, and works in conjunction with l-arginine to increase growth hormone (gh) production.l-taurine (1g) a conditionally essential amino acid, taurine exerts a number of beneficial effects in the body. taurine enhances cellular hydration, promoting greater endurance and stamina, and also improves mood and focus due to large concentrations of the amino being present in the brain.threonine (950mg) supports optimal functioning of the cardiovascular, liver, central nervous, and immune systems of the body. research notes that threonine also helps maintain the protein balance in the body and accelerate recovery from an injury.l-alanine (500mg) plays a crucial role in protein synthesis, even though it’s classified as a nonessential amino acid. additionally, alanine can also convert to pyruvate, a compound essential for glucose production and blood sugar regulation.methionine (300mg) vital to the production of creatine and carnitine in the body. as a result, this essential amino acid aids energy production, athletic performance, cellular hydration, and most importantly, lean mass gains..phenylalanine (150mg) as a precursor to tyrosine, phenylalanine increases production of three key neurotransmitters -- dopamine, epinephrine, and adrenaline. these three neurotransmitters enhance alertness and mood, and serve a critical role in muscle activation. instructionsfor an amino acid boost, take one (1) scoop first thing in the morning.for pre-workout energy, take one (1) to two (2) scoops 30 minutes before training.for post-workout recovery, take one (1) to two (2) scoops immediately after training.https://redsupps.co.uk/products/blackstone-labs-resurgence-bcaa-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/bcaaresurgence-pinacolada-purple_600x600_crop_center.png?v=1541617247Blackstone Labs new 369644797989in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsBCAA 29.00GBP shopify_734003363891_8712907325491Biovape revolutionary delivery systembiovape breathable vitamins utilize a revolutionary new delivery system that allows for maximum new bioavailability and absorption of your vitamins through aromatherapy rather than ingestion. fact is, we don’t absorb everything we ingest, but breathing in your vitamins allows for fast delivery to the bloodstream.vitamin packed & potentbiovape’s vitamin b12 is an extremely potent source of vegan vitamin b12. due to the unique delivery method of aromatherapy, this aromatherapy supplement allows for less supplement to be used to get the same desired effect.maximize your servings|1 serving of biovape b12 contains 8,333% of the percent daily value of vitamin b12. one serving is 5-10 normal sized breaths, and each vape pen contains about 28 servings.great taste and flavorwith high-quality r&d, biovape features an incredible tasting citrus flavor. enjoy the taste of your aromatherapy vitamins daily!perfect for vegansbiovape b12 is perfect for vegans who need to supplement vitamin b12 into their diet due to a lack of meat. biovape contains absolutely no nicotine, no caffeine, and has no calories.https://redsupps.co.uk/products/biovapehttps://cdn.shopify.com/s/files/1/2544/1734/products/1_transp_600x600_crop_center.png?v=1541617272Biovape new 734003363891in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsBreathable Vitamins 19.00GBP shopify_522463838259_7019761598515Blo benefitsmind blowing pumps †vascularity / fullness †nutrient absorption †stim-free formula †as our standards are constantly surpassing new heights in this industry, we knew this product had to be truly different from the industry cliche. with quality ingredients, in clinical servings, all formulated under one lid, blo® is designed to induce mind blowing pumps, vascularity and explosive strength. you may take blo® as a standalone product or even stack with loco® if desired!https://redsupps.co.uk/products/blohttps://cdn.shopify.com/s/files/1/2544/1734/products/2018-BLO-MOCKUP_1024x_e81e9361-5270-4c32-8b77-aa7c5ae70765_600x600_crop_center.jpg?v=1541617281MYOBLOX new 522463838259in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 37.00GBP shopify_522463838259_8710103203891Blo benefitsmind blowing pumps †vascularity / fullness †nutrient absorption †stim-free formula †as our standards are constantly surpassing new heights in this industry, we knew this product had to be truly different from the industry cliche. with quality ingredients, in clinical servings, all formulated under one lid, blo® is designed to induce mind blowing pumps, vascularity and explosive strength. you may take blo® as a standalone product or even stack with loco® if desired!https://redsupps.co.uk/products/blohttps://cdn.shopify.com/s/files/1/2544/1734/products/2018-BLO-MOCKUP_1024x_e81e9361-5270-4c32-8b77-aa7c5ae70765_600x600_crop_center.jpg?v=1541617281MYOBLOX new 522463838259in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 37.00GBP shopify_522463838259_8710120276019Blo benefitsmind blowing pumps †vascularity / fullness †nutrient absorption †stim-free formula †as our standards are constantly surpassing new heights in this industry, we knew this product had to be truly different from the industry cliche. with quality ingredients, in clinical servings, all formulated under one lid, blo® is designed to induce mind blowing pumps, vascularity and explosive strength. you may take blo® as a standalone product or even stack with loco® if desired!https://redsupps.co.uk/products/blohttps://cdn.shopify.com/s/files/1/2544/1734/products/2018-BLO-MOCKUP_1024x_e81e9361-5270-4c32-8b77-aa7c5ae70765_600x600_crop_center.jpg?v=1541617281MYOBLOX new 522463838259in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 37.00GBP shopify_522463838259_8710136299571Blo benefitsmind blowing pumps †vascularity / fullness †nutrient absorption †stim-free formula †as our standards are constantly surpassing new heights in this industry, we knew this product had to be truly different from the industry cliche. with quality ingredients, in clinical servings, all formulated under one lid, blo® is designed to induce mind blowing pumps, vascularity and explosive strength. you may take blo® as a standalone product or even stack with loco® if desired!https://redsupps.co.uk/products/blohttps://cdn.shopify.com/s/files/1/2544/1734/products/2018-BLO-MOCKUP_1024x_e81e9361-5270-4c32-8b77-aa7c5ae70765_600x600_crop_center.jpg?v=1541617281MYOBLOX new 522463838259in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 37.00GBP shopify_1488818012211_13400387780659Block e3 descriptionblock e3 is one of our favourites from the transdermal range, purely because its so unique in function! the active ingredients work synergistically to tackle estrogen dominance at the site by blocking aromatase activity. increased aromatase activity will increase estrogen and lower testosterone and increase the activation of the mainly proliferative estrogen receptors to induce fat cell production in localised tissues. it also works to improve the overall appearance of the isolated pockets of fat that love to cling to us for dear life on areas such as the hips, thighs, buttocks, arms, stomach and for men gynecomastia.block e3 – body shaping serumblock e3 is a shaping cream specifically formulated to estrogen dominant fatty areas (pictured below). the net result is:an improved appearance of regional fat deposits that cause gynaecomastia in men (‘man boobs’)an improved appearance of isolated pockets of fat on hips and buttocks in women and mena secret weapon used by bodybuilders and physique models for pre-comp sculptinga specifically formulated cream for tightening, smoothing and firming unsightly fat depositsthe effects of estrogen dominance include:increases fat deposits and accumulation in isolated regions (pictured below)the creation of an estrogen dominant body shape (pictured below)an increased inter-muscular fat thereby reducing muscle definitiona reduced muscle mass and decrease muscle fibre sizeestrogen body shapeas estrogen is fat soluble, it is stored in the subcutaneous fat in the following areas:hipsbuttocksthighsbreasts and chestbacks of the arms‘love handles’lower backlower abdomenfigure 1. the storage sites for the estrogensestrogen dominance in menraised intracellular oestradiol levels in men, induce and promote obesity, gynaecomastia (man boobs), metabolic syndrome, type two diabetes, benign prostatic hypertrophy and prostate cancer.2estrogen dominance in womenelevated estrogen: androgen ratio in women can manifest as changes in body shape that include increased subcutaneous fat on the lower abdomen, buttocks, hips and thighs. isolated pockets of fat and cellulite on the widest point of the hips are a common sign.causes of estrogen dominance in men and womenincreased aromatase activity, converting testosterone to estrogenexcessive stressobesityinflammationreactive toxins and xeno-estrogens (from petrochemicals, plastics, bisphenol a (bpa), pollutions, pesticides)anabolic steroidscertain foods that contain high levels of estrogen (e.g. milk)medications that cause hypogonadism and have anti-androgenic effects (such as the contraceptive pill)iodine deficiencyestrogen dominance causes a vicious cycleone of the key features of estrogen dominance is that it can be a self-perpetuating vicious cycle that can be isolated from the rest of the body. this means that the normal regulation and hormonal modulation pathways can sometimes not be able to control it or even be aware that it is happening in localised areas. estrogen generated in fat cells and breast tissue is predominately used locally and not transported around the body and therefore does not necessarily activate negative feedback mechanisms and triggering subsequent reduction in estrogen production. the net result means you could be making estrogen without your body realising you already have too much of it in certain tissues.aromatase converts testosterone to estrogentestosterone is metabolised to oestradiol by aromatase, in the cytoplasm of adipocytes, breast cells, endothelial cells and prostate cells, to increase intracellular oestradiol concentration at the expense of testosterone.increased aromatase activity will increase estrogen and lower testosterone and increase the activation of the mainly proliferative estrogen receptors to induce fat cell production in localised tissues.block e3 for site specific action.block e3 contains 3 effective synergistic ingredients to combat estrogen dominance. block e3 is designed to work locally on regional fat deposits and breast tissue and not systemically. block e3 is specifically designed to work on isolated pockets of fat and breast tissue.block e3 contains the following active ingredients.oroxylum indicum (midnight horror)fucus vesiculosus (bladderwrack)piper nigrum (black pepper) essential oiloroxylum indicum (midnight horror)aromatase inhibitorantioxidantanti-allergicanti-bacterialanti-inflammatoryestrogen receptor blockermidnight horror contains chrysin and baicaleinmidnight horror (oroxylum indicum) is an extremely potent and natural source of the powerful flavones chrysin (5, 7-dihydroxyflavone, or 5, 7-dihydroxy-2-phenyl-(9ci)) and baicalein. midnight horror is an aromatase inhibitor and estrogen blocker.the flavones chrysin and baicalein inhibit the activity of aromatase (cyp19), thus decreasing estrogen biosynthesis and producing anti-estrogenic effects. baicalein also blocks estrogen receptor activity.chrysin only works transdermallyflavones such as chrysin have very poor oral bioavailability, less than 5% of an oral dose can get past first pass metabolism and digestive tract. flavones can however be efficiently absorbed when applied to the skin.fucus vesiculosus (bladderwrack)exerts anti-estrogenic effectsaromatase inhibitorinhibits the binding of oestradiol to estrogen receptorsantioxidant, anti-allergic and anti-inflammatorypossesses anti-aging activities for skin; improving dermal collagen integrity and elasticity.inhibits glycation, which is damage to protein structures caused by binding and oxidation of sugar.bladderwrack is an estrogen blockermany scientific papers have discussed and studied the asian diet its association with lower incidences of estrogen related cancers. researchers have always surmised it to be due to the soy, seafood and green tea. more recently researchers have been led to believe it may actually be due to the kelp and its iodine content they consume regularly and use as part of cosmetics and skincare.bladderwrack is an estrogen receptor blockerbladderwrack is a potent source of iodine and other compounds including fucoidan and fucophlorethols, which have demonstrated powerful anti-estrogen properties.3 bladderwrack extract inhibits the binding of oestradiol (e2) to estrogen receptor alpha and beta.2 bladderwrack is also an aromatase inhibitor. phloroglucinol derivatives, belonging to the class of fucophlorethols, isolated from bladderwrack have been shown to be potent aromatase inhibitors.bladderwrack is a rich source of beneficial iodinebladderwrack is a rich source of iodine, which has important functions in breast tissue in men and women. iodine helps to maintain normal breast tissue architecture and function and low iodine produces a hyper-estrogenic state. iodine deficiency alters the structure and function of mammary gland alveolar cells and makes them highly sensitive to stimulation by oestradiol.topical application of the active ingredientsone of the great challenges in medicine is getting the drug/nutrient/herb to the area where it is needed. e3 blocker deals with this by delivering its active ingredients straight to where it is needed. as mentioned, taking some agents orally isn’t the best way to take them. here at atp science we take this problem seriously and have developed products like block e3 which directly targets the area. see the graphic below on how our products get to where they are needed.figure 2. the mechanism of action for the delivery of the active ingredients in block e3 and subcutyour estrogen detox strategyavoid exposure to exogenous estrogen (plastics and pollutants etc.) and isolate and address your cause (e.g. obesity or hypothyroid function). fat cells produce estrogen so losing fat may be your first option. see atp science amp-v product data for effective fat loss solutions.block the pathways such as the aromatase pathway, which makes excessive estrogen from your valuable testosteronemake sure the active components are working where they are needed and not taken orally with the hope they find their way to the affected areas.it is best to avoid excessive estrogens in the body in the first place. most excessive estrogens come from carrying too much body fat. thus, the obvious strategy to reduce estrogens is to burn fat by fasting exercise (first thing in the morning) and eating a lower carbohydrate diet. consider block e3 and supplementing with alpha prime and / or alpha venus (other great ways to reduce estrogen).excessive estrogen untreated can lead to poorer health outcomes. if you believe your hormones are not balanced, please see your health care practitioner.https://redsupps.co.uk/products/block-e3https://cdn.shopify.com/s/files/1/2544/1734/products/BlockE3-1_600x600_crop_center.jpg?v=1541617291ATP Science new 1488818012211in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsTransdermal Estrogen Blocker 39.99GBP shopify_1638343180339_15892167753779Bloodshr3d black magic edition key features extremely potent stimulant matrix, which kicks in quickly for energy, euphoria, appetite control and mood supporthelps reduce body fat through multiple clinically researched pathways which promote thermogenesis and energy expenditurepowdered formula allows users to adjust dosing to their needs, available in a series of unique and delicious flavourscontains vegan sourced instantized bcaa’s to provide an anti-catabolic effect, protecting against muscle loss while dieting  why?bloodshr3d black magic edition features an innovative, flexible powdered formula, combining a number of extremely potent stimulants to suppress appetite and increase energy expenditure. while also adding including ingredients that support mood, improves fatty acid mobilisation and target stubborn body fat.when?as a clear-cut fat burner it should be used when fat loss is your goal. it is best used in cycles of 6-10 weeks for optimal results. it can be stacked with other non-stimulant fat burners, such as assass1nate for further enhanced fat loss.whom?this product can be used by both men and women over the age of 18 years who are interested in a powdered flexibly dosed fat burner, which provides potent energy, appetite suppression and thermogenesis. key ingredients if bloodshr3d black magic edition:green coffee bean extract - is derived from the green or raw coffee bean and contains several components including chlorogenic acid. it has been shown to have antioxidant properties, as well promotes the release of fatty acids and healthy blood glucose levels.progbb®-known as gamma - butyrobetaine ethyl ester chloride, is a compound which enhances the body's natural tendency to produce l-carnitine. it is said to increase workout capacity, decrease fat accumulations and promote healthy cardiovascular function.rutin - is a non-nutritive component of several foods, including apples and citrus. it is well known for its antioxidant properties and its ability to mitigate inflammation. rutinmay have a beneficial effect on muscle mitochondria and ampk activation, leading to a reduction in body weight and adipose tissue mass.taurine - has several benefits including assisting with insulin sensitivity, reversing cardiovascular disease factors and promoting metabolic health.caffeine anhydrous – the most popular and common stimulant on the market to enhance energy and performance. it also effectively boosts lipolysis and suppresses appetite.ksm-66 - also known as ashwagandha, this ingredient is a multifaceted adaptogen offering wide ranging benefits. it has been shown to improve semen quality by increasing serum levels of testosterone and luteinizing hormone. ashwagandha also helps to control levels of cortisol in the body, allowing better stress control, fat loss and recovery.acetyl-l-carnitine - a form of carnitine with an acetyl group attached. it acts as an antioxidant has is well known as a transporter of long-chain fatty acids into the mitochondria so they can be oxidized to produce energy. acetyl-l-carnitine has also been shown to help increase luteinizing hormone and sperm motility.vanillin - commonly used as a flavoring agent in foods, it also a selective agonist of transient receptor potential vanilloid subtype 1. they are known to increase energy metabolism and induce lipolysis.julgansregia extract - is a species of walnut tree indigenous to southwest china and the himalayas. more importantly, j. regia is loaded with a number of alkaloids, which work to significantly enhance focus and energy.eriajarensis - contains several pea-based compounds including: n-methyl-pea, n,n-dimethyl-pea, and n-phenethyl dimethylamine. e. jarensis gives users a significant “euphoric” feel that lasts significantly longer than regular pea.raspberry ketone is a chemical found in red raspberries. research shows that raspberry ketones might increase metabolism. it may also promote higher levels hormone in the body called adiponectin. adiponectin can increase the rate at which the body burns fat and reduce appetite.instaminos™ bcaas – featuring a 2.5g dose of a 2:1:1 ratio to promote an anti-catabolic effect and enhance muscle protein synthesis. ensuring the weight loss will be fat mass and not hard earned muscle mass.directionsfor optimal fat loss effects, consume a full serving of bloodshr3d black magic edition in 8oz of water, on an empty stomach during the morning. an additional half serving can be used in the afternoon, if desired.do not exceed four scoops in a 24 hour period.https://redsupps.co.uk/products/bloodshr3d-black-magic-editionhttps://cdn.shopify.com/s/files/1/2544/1734/products/bloodshr3d-pre-workout_600x600_crop_center.jpg?v=1544868369Olympus Labs new 1638343180339in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsFat Burner 34.99GBP shopify_675573891123_8294826410035Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_675573891123_8294883393587Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_675573891123_8294883459123Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_675573891123_8294883491891Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_675573891123_8294883524659Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_675573891123_8294883557427Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_675573891123_8294883590195Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_675573891123_8294883622963Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_675573891123_8294883655731Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_675573891123_8294883688499Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_675573891123_8294883721267Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_675573891123_8294883754035Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_675573891123_8294883786803Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_675573891123_8294883819571Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_675573891123_8294883852339Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_675573891123_8294883885107Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_675573891123_8294883917875Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_675573891123_8294883950643Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1541617326Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 119.50GBP shopify_369639292965_4714174480421Brutal 4ce key featureswet mass gainsconverts to testosteronenot liver toxic descriptiongaining mass isn’t easy; it takes years of hard training and big eating. in an ideal world, you’d have all the time in the world to train, eat, and sleep. but you don’t live in a perfect world, you live in a world that demands results now, not 5-10 years from now.brutal 4ce is a serious muscle-builder for serious bodybuilders and athletes looking to pack on the size in a hurry. utilizing the anabolic power of 4-dhea, brutal 4ce will help you add weight to the bar each workout, skyrocket testosterone levels, and build slabs of lean muscle in no time at all.  ingredients4-dhea blend (65mg) brutal 4ce assaults your muscles with three highly effective forms of 4-dhea (4 androstene-3b-ol,17-one). 4-dhea undergoes a 2-step conversion beginning with androstenediol and ultimately ending as testosterone -- the ultimate anabolic hormone for building size and strength. a common problem of 4-dhea products of the past was that they suffered from poor bioavailability, meaning you’d have to take tremendous amounts of the compound just to get minimal effectiveness. this put users at an increased risk of developing unwanted side effects. brutal 4ce uses liposomal delivery technology to create a 4-dhea supplements that’s 99% bioavailable, making brutal 4ce extremely efficient than the prohormones of yesteryear. increased effectiveness, less risk, bigger gains using brutal 4ce. directionsas a dietary supplement, take one (1) tablet two (2) times per day. do not exceed two (2) tablets daily.https://redsupps.co.uk/products/new-blackstone-labs-brutal-4ce-60tab-serious-muscle-gains-liposomal-deliveryhttps://cdn.shopify.com/s/files/1/2544/1734/products/brutal4ce_7342deea-d3ca-4c4e-b58b-21459c9094ce_600x600_crop_center.png?v=1541617332Blackstone Labs new 369639292965in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Builder 49.99GBP shopify_1565032382515_15386257293363C-1000 with 100 mg of bioflavonoids C-1000 with 100 mg of bioflavonoidsvitamin c is an essential nutrient well known for its vital role in the immune system. it is a highly effective antioxidant that can protect the body's structures from oxidative damage generated during normal metabolism. vitamin c is also necessary for the production of collagen and is therefore important for skin, bone, and joint health. this product includes bioflavonoids, which work synergistically to support vitamin c utilization.suggested usetake 1 capsule daily.other ingredientscellulose (capsule), stearic acid (vegetable source), magnesium stearate (vegetable source) and silica.https://redsupps.co.uk/products/c-1000-with-100-mg-of-bioflavonoidshttps://cdn.shopify.com/s/files/1/2544/1734/products/now_c-1000_600x600_crop_center.jpg?v=1541617354NOW FOODS new 1565032382515in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsEssential Vitamin 16.99GBP shopify_587829575731_7563126931507Caffeinated peanut powder 400g The irresistible taste of sweet golden honey and roasted peanuts blended into a powder. made from real peanuts but with less fat. supplement your workout and your life with quality protein to feel good and be healthy. this peanut powder is so versatile you can use it in, or on almost anything, reconstituted or as a powder.https://redsupps.co.uk/products/chocolate-chaos-powder-caffeinatedhttps://cdn.shopify.com/s/files/1/2544/1734/products/POWDER-CHOCOLATE-CHAOS_1024x1024_00738c39-7085-431d-9486-96621d864ec8_600x600_crop_center.jpg?v=1541617402Sinister Labs new 587829575731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPeanut Powder 15.99GBP shopify_587829575731_7565063520307Caffeinated peanut powder 400g The irresistible taste of sweet golden honey and roasted peanuts blended into a powder. made from real peanuts but with less fat. supplement your workout and your life with quality protein to feel good and be healthy. this peanut powder is so versatile you can use it in, or on almost anything, reconstituted or as a powder.https://redsupps.co.uk/products/chocolate-chaos-powder-caffeinatedhttps://cdn.shopify.com/s/files/1/2544/1734/products/POWDER-CHOCOLATE-CHAOS_1024x1024_00738c39-7085-431d-9486-96621d864ec8_600x600_crop_center.jpg?v=1541617402Sinister Labs new 587829575731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPeanut Powder 15.99GBP shopify_587829575731_7565063553075Caffeinated peanut powder 400g The irresistible taste of sweet golden honey and roasted peanuts blended into a powder. made from real peanuts but with less fat. supplement your workout and your life with quality protein to feel good and be healthy. this peanut powder is so versatile you can use it in, or on almost anything, reconstituted or as a powder.https://redsupps.co.uk/products/chocolate-chaos-powder-caffeinatedhttps://cdn.shopify.com/s/files/1/2544/1734/products/POWDER-CHOCOLATE-CHAOS_1024x1024_00738c39-7085-431d-9486-96621d864ec8_600x600_crop_center.jpg?v=1541617402Sinister Labs new 587829575731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPeanut Powder 15.99GBP shopify_588107513907_7565561069619Caffeinated protein peanut spread 340g descriptionwhat is better than a fantastic source of protein, blend, quick and a variety of awesome flavours? nothing really…. which is why sinister labs angry mills peanut butter blend is top.  this unique peanut blend contains high quality proteins and is a fantastic energy source to get you through your day! as an athlete if you’re on the go and require a delicious and quick meal packed with protein then this spread is for you! power yourself through those lazy days and acquire protein easier than ever!for the athletes who desire fantastic taste and high-quality macro-nutrients then this is for you!https://redsupps.co.uk/products/caffeinated-protein-peanut-spread-340ghttps://cdn.shopify.com/s/files/1/2544/1734/products/12oz-Chocolate-Craze-Caff_1024x1024_d545215f-4891-4a22-b21c-e7244b8d8ab2_600x600_crop_center.jpg?v=1541617497Sinister Labs new 588107513907in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCaffeinated Protein Peanut Spread 10.99GBP shopify_588107513907_7565561102387Caffeinated protein peanut spread 340g descriptionwhat is better than a fantastic source of protein, blend, quick and a variety of awesome flavours? nothing really…. which is why sinister labs angry mills peanut butter blend is top.  this unique peanut blend contains high quality proteins and is a fantastic energy source to get you through your day! as an athlete if you’re on the go and require a delicious and quick meal packed with protein then this spread is for you! power yourself through those lazy days and acquire protein easier than ever!for the athletes who desire fantastic taste and high-quality macro-nutrients then this is for you!https://redsupps.co.uk/products/caffeinated-protein-peanut-spread-340ghttps://cdn.shopify.com/s/files/1/2544/1734/products/12oz-Chocolate-Craze-Caff_1024x1024_d545215f-4891-4a22-b21c-e7244b8d8ab2_600x600_crop_center.jpg?v=1541617497Sinister Labs new 588107513907in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCaffeinated Protein Peanut Spread 10.99GBP shopify_588107513907_7565561135155Caffeinated protein peanut spread 340g descriptionwhat is better than a fantastic source of protein, blend, quick and a variety of awesome flavours? nothing really…. which is why sinister labs angry mills peanut butter blend is top.  this unique peanut blend contains high quality proteins and is a fantastic energy source to get you through your day! as an athlete if you’re on the go and require a delicious and quick meal packed with protein then this spread is for you! power yourself through those lazy days and acquire protein easier than ever!for the athletes who desire fantastic taste and high-quality macro-nutrients then this is for you!https://redsupps.co.uk/products/caffeinated-protein-peanut-spread-340ghttps://cdn.shopify.com/s/files/1/2544/1734/products/12oz-Chocolate-Craze-Caff_1024x1024_d545215f-4891-4a22-b21c-e7244b8d8ab2_600x600_crop_center.jpg?v=1541617497Sinister Labs new 588107513907in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCaffeinated Protein Peanut Spread 10.99GBP shopify_588107513907_7565561167923Caffeinated protein peanut spread 340g descriptionwhat is better than a fantastic source of protein, blend, quick and a variety of awesome flavours? nothing really…. which is why sinister labs angry mills peanut butter blend is top.  this unique peanut blend contains high quality proteins and is a fantastic energy source to get you through your day! as an athlete if you’re on the go and require a delicious and quick meal packed with protein then this spread is for you! power yourself through those lazy days and acquire protein easier than ever!for the athletes who desire fantastic taste and high-quality macro-nutrients then this is for you!https://redsupps.co.uk/products/caffeinated-protein-peanut-spread-340ghttps://cdn.shopify.com/s/files/1/2544/1734/products/12oz-Chocolate-Craze-Caff_1024x1024_d545215f-4891-4a22-b21c-e7244b8d8ab2_600x600_crop_center.jpg?v=1541617497Sinister Labs new 588107513907in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCaffeinated Protein Peanut Spread 10.99GBP shopify_1638325846067_15892081344563Cardar1ne olympus labs cardarine is a type of supplement which is often considered to be a s.a.r.m but technically it is not but instead works via its interactions with the ppar receptor. cardarine has been studied extensively and shown to exhibit potent physiological effects in increasing performance for athletes. as much as s.a.r.m.s/ppar receptor agonists are associated with bodybuilders seeking the holy grail of muscle and strength enhancement without the use of steroids, cardarine is most notably effective in boosting muscle endurance enabling users to massively increase the number of reps they can perform as well as improving cardiovascular endurance, something which has made it popular among elite endurance sport athletes.what results can you expect?within the very first week of using cardarine both of our testers reported very similar results in the form of increased endurance and fat loss with particularly noticeable effects when performing hiit style cardio. at the same time, both of our testers also stated that their weight training workouts felt much easier with both a reduced perception of exertion and ability to maintain a high level of performance even deep into their workouts.when it comes to fat loss, even without dieting both reported big increases in vascularity and remarked that while it did not make them feel less hungry, it would be a great addition when dieting to enable you to reach your desired condition.https://redsupps.co.uk/products/cardar1nehttps://cdn.shopify.com/s/files/1/2544/1734/products/Cardar1ne_600x600_crop_center.jpg?v=1544865752Olympus Labs new 1638325846067in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsSARM 45.00GBP shopify_1580211339315_15427527147571Cbd infuse drops 1,000mg cbd infuse drops 1,000mgfuel your body and mind with cbd infuse drops, the most concentrated, most powerful tinctures available on the market today.comes in a 30ml bottle of medium-chain triglyceride (mct) oil which infused with cbd. available in a choice of two extremely popular flavours, natural and fruity.infuse is available in a range of strengths, from 1,000mg to a whopping 10,000mg of infused cbd!30ml bottle ingredients: mct oil, cbd oil, natural fruit extracts how to use?our cbd oils come packaged in a special bottle with a squeezable pipette dropper. simple squeeze the dropper in the bottle to fill the pipette. you will be able to see the oil within the pipette. simply squeeze 2-3 drops under the tongue and hold for 60-90 secs for the quickest way to get the oil into your bloodstream. this is because they are absorbed quicker by avoiding metabolism with the liver. alternatively, if preferred, you can drip the cbd oil into any food or drink – though this may slightly affect the base flavour.the cbd will stay in your system for 4-6 hours, so for around-the-clock benefits we would recommend twice a day, or alternatively as and when required.https://redsupps.co.uk/products/cbd-infuse-drops-1-000mghttps://cdn.shopify.com/s/files/1/2544/1734/products/natural-1000_1600x1600_crop_center_8d2edbe6-936c-49f9-adf5-fd176812e983_600x600_crop_center.jpg?v=1542131729CBD ASYLUM new 1580211339315in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCBD OIL 69.99GBP shopify_1580211339315_15427527180339Cbd infuse drops 1,000mg cbd infuse drops 1,000mgfuel your body and mind with cbd infuse drops, the most concentrated, most powerful tinctures available on the market today.comes in a 30ml bottle of medium-chain triglyceride (mct) oil which infused with cbd. available in a choice of two extremely popular flavours, natural and fruity.infuse is available in a range of strengths, from 1,000mg to a whopping 10,000mg of infused cbd!30ml bottle ingredients: mct oil, cbd oil, natural fruit extracts how to use?our cbd oils come packaged in a special bottle with a squeezable pipette dropper. simple squeeze the dropper in the bottle to fill the pipette. you will be able to see the oil within the pipette. simply squeeze 2-3 drops under the tongue and hold for 60-90 secs for the quickest way to get the oil into your bloodstream. this is because they are absorbed quicker by avoiding metabolism with the liver. alternatively, if preferred, you can drip the cbd oil into any food or drink – though this may slightly affect the base flavour.the cbd will stay in your system for 4-6 hours, so for around-the-clock benefits we would recommend twice a day, or alternatively as and when required.https://redsupps.co.uk/products/cbd-infuse-drops-1-000mghttps://cdn.shopify.com/s/files/1/2544/1734/products/natural-1000_1600x1600_crop_center_8d2edbe6-936c-49f9-adf5-fd176812e983_600x600_crop_center.jpg?v=1542131729CBD ASYLUM new 1580211339315in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCBD OIL 69.99GBP shopify_369641652261_4714184114213Chosen1 chosen1 dry lean gainsmuscle density and definitionno estrogen conversion descriptionthe problem with conventional bulking is that in your effort to increase size and strength, you’re all but guaranteed to increase body fat too. some genetically gifted out there put on less fat than others, but the fact remains if you want to build more muscle, you’re stuck with added fat.but not anymore. now you have the choice to build as much lean mass as you want, without the added fat, with the chosen 1. this revolutionary muscle-building supplement is for the aggressive athlete looking to maximize lean gains but minimize fat gain. chosen 1 harnesses the power of 1-dhea, a compound proven to boost size, strength, and aggression.  ingredients1-dhea blend (65mg) chosen1 contains three potent forms of 1-dhea (1 androstene-3b-ol,17-one, which provide sustained release all day long. this ensures you have elevated levels of this powerful muscle builder throughout the day. 1-dhea undergoes a 2-step conversion process, first converting to 1-androstenediol then converting to 1-testosterone, a powerful derivative of testosterone. the advantages to using 1-dhea over any other muscle building supplement is that it does not aromatize to estrogen and touts an anabolic:androgenic ratio of 1:2, meaning drier gains, little fat accumulation, more aggression in the gym, and better performance in the bedroom! chosen1 employs liposomal delivery to yield a 1-dhea supplement that’s 99% bioavailable, ensuring this powerful anabolic survives the tortuous journey through the gi system, hitting your muscles with maximum effectiveness. increased size, decreased body fat, and better performance make the chosen1 an easy choice!  directionsas a dietary supplement, take one (1) tablet two (2) times per day. do not exceed two (2) tablets daily.https://redsupps.co.uk/products/new-blackstone-labs-chosen-1-60tab-lean-dry-gains-gym-aggression-liposomalhttps://cdn.shopify.com/s/files/1/2544/1734/products/chosen1_600x600_crop_center.png?v=1541617530Blackstone Labs new 369641652261in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Builder 49.99GBP shopify_733984456755_8712096415795Contra benefitsstrength gains †ripped physique †suppress cortisol †estrogen and cortisol are the last hormones we want abundantly present in our body when trying to build a ripped hard physique. when these two hormones are unfavorably balanced, the body undergoes changes that can result in a soft bloated appearance and weaken performance in and out of the gym. another big problem that stems from these specific hormones is that belly fat (as well as any stubborn fat) becomes virtually impossible to lose which can hinder progression in your sport as well as your personal body composition goals. this is a big, yet surprisingly common obstacle that gym enthusiasts and even the most serious athletes have to hurdle over. in comes contra®, a novel aromatase inhibitor and cortisol suppressing king. by reducing the levels of harmful estrogen metabolites and cortisol circulating in the body can in turn promote a healthy balance of testosterone supporting gains in ripped hard muscle.†https://redsupps.co.uk/products/contrahttps://cdn.shopify.com/s/files/1/2544/1734/products/CONTRA-MOCKUP_600x600_crop_center.jpg?v=1541617537MYOBLOX new 733984456755in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCycle Support 39.00GBP shopify_1487430352947_13391212445747Cort rx descriptionthe hypothalamic pituitary adrenal (hpa) axis the key is to provide a strategy to manage the hpa axis.remove burdenavoid stress from people and places you can avoidimmune activation – toxicity, allergies, intolerances, infection, infestation and autoimmunityinflammation – immune activation, injury and stresstoxic exposure – chemicals, colourings, additives, preservatives, fertilizers, pesticides, drugs, smoking, alcohol etc.electromagnetic radiationadaptogenic herbs all of which are found in the cort rxschisandra chinensisschisandra chinensis is an adaptogen, helping the body adapt to physical and mental stress. it improves dexterity, focus and co-ordination. schisandra corrects respiratory acidosis and improves performance. one study on thoroughbreds showed an improvement of 6 lengths in an 800m race.schisandra improves physical performanceschisandra chinensis has been shown to exhibit a remarkable effect on the physical performance of race horses. when treated with schisandra, horses were able to complete the 800 m in a significantly shorter and the speed reached by the schisandra-treated horses was also significantly higher than when saline treated. this study indicated that schisandra extract was able to induce a greater response to physical effort. this was translated into a decrease of the time (1.8 s less) for the completion of the 800m race, equivalent to an improvement of 6 lengths in an 800m race.schisandra improves mental performanceschisandra enhances memory, focus and concentration span via cholinergic function and works as an acetylcholine esterase inhibitor, thereby preserving acetylcholine levels and activity in nerve synapses.helps to adapt to all stressorsanti-anxietyimprove cognition and brain functionimproves resilienceliver protectantantioxidantanti-inflammatorywithania somniferawithania modulates hpa axiswithania enhances hypothalamic pituitary gonadal (hpg) axiswhile controlling the hpa axis; withania allows and encourages the hpg axis to fire for reproduction, regeneration and repair. while controlling the hpa axis; withania enhances thyroid hormone production and activity.rhodiola roseaturmeric (curcuma longa)turmeric will take the burden off the whole hpa axis and reduce the frequency and intensity of our survival response while supporting genuine energy levels and quality of life.https://redsupps.co.uk/products/cort-rxhttps://cdn.shopify.com/s/files/1/2544/1734/products/CortRX-front_600x600_crop_center.jpg?v=1541617571ATP Science new 1487430352947in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAdaptogenic Herbal Formulation 42.99GBP shopify_520029438003_6992302964787Crit 30 caps crit is a high quality nootropic that will greatly improve focus and boost your energy. taken 30 minutes before you game, crit will increase your apm, last hits, accuracy, and overall awareness.what in crit gives you energy?caffeine anhydrous 200mgcaffeine like you'd find in monster, red bull, or coffee... except we have 3x the amount per serving.caffeine is the most popular and well known psychoactive drug. it's commonly found in coffee, tea, energy drinks, soft drinks and even chocolate. caffeine seems to have acute cognitive effects. it seems to be able to consistently increase alertness and attention.l-theanine 200mga stimulant most commonly found in tea, which pairs up very well with caffeine anhydrous to kick your ass.l-theanine is one of the main psychoactive compounds found in tea. l-theanine is extremely safe and has been shown to mitigate the negative aspects of caffeine, such as anxiety, increased blood pressure and diminished sleep quality, while possibly improving upon the positive aspects. its ability to enhance attention has been repeatedly verified.black pepper extract (bioperine®) 25mghelps your body to better absorb and utilize other ingredients.black pepper has been used in the human diet since ancient times and is one of the most widely used spices throughout the world. it has also been used in various traditional medicines, preservatives and health supplements. bioperine® should be co-administered with various nutrients to enhance their bioavailability. in general, black pepper extract was found to enhance absorption of nutrients by at least 30%.what in crit helps you focus?alpha-gpc 245mg enhances concentration and learning ability. standard doses start at 100mg per serving. we've nearly tripled that amount to ensure success.alpha-gpc (choline alphoscerate) is a highly bioavailable choline source. alpha-gpc is a product of lecithin commonly found in food and is a natural component of human breast milk. it's also present in brain tissue as a product of phospholipid metabolism. after oral consumption, alpha-gpc is converted to phosphorylcholine which can increase acetylcholine synthesis and release.huperzine a 25mcgenhances mental intake and memory. practice makes perfect. be more perfecter.huperzine a is a naturally occurring acetylcholinesterase inhibitor found in huperzia serrata. huperzia serrata has a long history of use in traditional chinese medicine where it was used for fever, inflammation, muscle strains and rheumatologic conditions. like other acetylcholinesterase inhibitors, there's evidence to suggest huperzine a can be used to help treat alzheimer's disease.https://redsupps.co.uk/products/crit-30capshttps://cdn.shopify.com/s/files/1/2544/1734/products/crit-capsule_1500x_629cc625-6486-4a8f-b295-e340291e3dba_600x600_crop_center.jpg?v=1541617578Good Game Labs new 520029438003in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsGaming Nootropics 29.00GBP shopify_520041562163_6992401956915Crit berry lemonade what in crit gives you energy?caffeine anhydrous 200mgcaffeine like you'd find in monster, red bull, or coffee... except we have 3x the amount per serving.caffeine is the most popular and well known psychoactive drug. it's commonly found in coffee, tea, energy drinks, soft drinks and even chocolate. caffeine seems to have acute cognitive effects. it seems to be able to consistently increase alertness and attention.l-theanine 200mga stimulant most commonly found in tea, which pairs up very well with caffeine anhydrous to kick your ass.l-theanine is one of the main psychoactive compounds found in tea. l-theanine is extremely safe and has been shown to mitigate the negative aspects of caffeine, such as anxiety, increased blood pressure and diminished sleep quality, while possibly improving upon the positive aspects. its ability to enhance attention has been repeatedly verified.black pepper extract (bioperine®) 25mghelps your body to better absorb and utilize other ingredients.black pepper has been used in the human diet since ancient times and is one of the most widely used spices throughout the world. it has also been used in various traditional medicines, preservatives and health supplements. bioperine® should be co-administered with various nutrients to enhance their bioavailability. in general, black pepper extract was found to enhance absorption of nutrients by at least 30%.crit is a high quality nootropic that will greatly improve focus and boost your energy. taken 30 minutes before you game, crit will increase your apm, last hits, accuracy, and overall awareness. what in crit helps you focus?alpha-gpc 245mg enhances concentration and learning ability. standard doses start at 100mg per serving. we've nearly tripled that amount to ensure success.alpha-gpc (choline alphoscerate) is a highly bioavailable choline source. alpha-gpc is a product of lecithin commonly found in food and is a natural component of human breast milk. it's also present in brain tissue as a product of phospholipid metabolism. after oral consumption, alpha-gpc is converted to phosphorylcholine which can increase acetylcholine synthesis and release.huperzine a 25mcgenhances mental intake and memory. practice makes perfect. be more perfecter.huperzine a is a naturally occurring acetylcholinesterase inhibitor found in huperzia serrata. huperzia serrata has a long history of use in traditional chinese medicine where it was used for fever, inflammation, muscle strains and rheumatologic conditions. like other acetylcholinesterase inhibitors, there's evidence to suggest huperzine a can be used to help treat alzheimer's disease.https://redsupps.co.uk/products/crit-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/crit-powder_1500x_2f829612-619d-4031-8ee0-6617a2333d21_600x600_crop_center.jpg?v=1541617579Good Game Labs new 520041562163in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsGaming Nootropics 29.00GBP shopify_1580174114867_15427427139635Drip it cbd oil 500mg drip it cbd oil 500mga pocket sized tincture with plenty of attitude.available in 500mg or 1,000mg strengths, but in a conventional bottle, the ideal product for any cbd user on the go. comes in natural or fruity flavours.10ml bottleingredients: mct oil, 500mg cbd oil, natural fruit extracts how to use?our cbd oils come packaged in a special bottle with a squeezable pipette dropper. simple shake the bottle well, squeeze the dropper in the bottle to fill the pipette. you will be able to see the oil within the pipette. simply squeeze 2-3 drops under the tongue and hold for 60-90 secs for the quickest way to get the oil into your bloodstream. this is because they are absorbed quicker by avoiding metabolism with the liver. alternatively, if preferred, you can drip the cbd oil into any food or drink – though this may slightly affect the base flavour.the cbd will stay in your system for 4-6 hours, so for around-the-clock benefits we would recommend twice a day, or alternatively as and when required.https://redsupps.co.uk/products/drip-it-cbd-oil-500mghttps://cdn.shopify.com/s/files/1/2544/1734/products/original-500_1600x1600_crop_center_4b5b13ca-1400-4ac8-aa4e-cbf740589180_600x600_crop_center.jpg?v=1542129819CBD ASYLUM new 1580174114867in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCBD OIL 42.99GBP shopify_1580174114867_15427427172403Drip it cbd oil 500mg drip it cbd oil 500mga pocket sized tincture with plenty of attitude.available in 500mg or 1,000mg strengths, but in a conventional bottle, the ideal product for any cbd user on the go. comes in natural or fruity flavours.10ml bottleingredients: mct oil, 500mg cbd oil, natural fruit extracts how to use?our cbd oils come packaged in a special bottle with a squeezable pipette dropper. simple shake the bottle well, squeeze the dropper in the bottle to fill the pipette. you will be able to see the oil within the pipette. simply squeeze 2-3 drops under the tongue and hold for 60-90 secs for the quickest way to get the oil into your bloodstream. this is because they are absorbed quicker by avoiding metabolism with the liver. alternatively, if preferred, you can drip the cbd oil into any food or drink – though this may slightly affect the base flavour.the cbd will stay in your system for 4-6 hours, so for around-the-clock benefits we would recommend twice a day, or alternatively as and when required.https://redsupps.co.uk/products/drip-it-cbd-oil-500mghttps://cdn.shopify.com/s/files/1/2544/1734/products/original-500_1600x1600_crop_center_4b5b13ca-1400-4ac8-aa4e-cbf740589180_600x600_crop_center.jpg?v=1542129819CBD ASYLUM new 1580174114867in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCBD OIL 42.99GBP shopify_1580186632243_15427463020595Drip it cbd oil, 1,000mg drip it cbd oil, 1,000mga pocket sized tincture with plenty of attitude.available in 500mg or 1,000mg strengths, but in a conventional bottle, the ideal product for any cbd user on the go. comes in natural or fruity flavours.10ml bottleingredients: mct oil, 1000mg cbd oil, natural flavourings how to use?our cbd oils come packaged in a special bottle with a squeezable pipette dropper. simple shake the bottle well, squeeze the dropper in the bottle to fill the pipette. you will be able to see the oil within the pipette. simply squeeze 2-3 drops under the tongue and hold for 60-90 secs for the quickest way to get the oil into your bloodstream. this is because they are absorbed quicker by avoiding metabolism with the liver. alternatively, if preferred, you can drip the cbd oil into any food or drink – though this may slightly affect the base flavour.the cbd will stay in your system for 4-6 hours, so for around-the-clock benefits we would recommend twice a day, or alternatively as and when required.https://redsupps.co.uk/products/drip-it-cbd-oil-1-000mghttps://cdn.shopify.com/s/files/1/2544/1734/products/original-1000_1600x1600_crop_center_c6bc805d-d313-4599-86fb-eae68906b2c9_600x600_crop_center.jpg?v=1542130436CBD ASYLUM new 1580186632243in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsDRIP IT CBD OIL 69.99GBP shopify_1580186632243_15427463053363Drip it cbd oil, 1,000mg drip it cbd oil, 1,000mga pocket sized tincture with plenty of attitude.available in 500mg or 1,000mg strengths, but in a conventional bottle, the ideal product for any cbd user on the go. comes in natural or fruity flavours.10ml bottleingredients: mct oil, 1000mg cbd oil, natural flavourings how to use?our cbd oils come packaged in a special bottle with a squeezable pipette dropper. simple shake the bottle well, squeeze the dropper in the bottle to fill the pipette. you will be able to see the oil within the pipette. simply squeeze 2-3 drops under the tongue and hold for 60-90 secs for the quickest way to get the oil into your bloodstream. this is because they are absorbed quicker by avoiding metabolism with the liver. alternatively, if preferred, you can drip the cbd oil into any food or drink – though this may slightly affect the base flavour.the cbd will stay in your system for 4-6 hours, so for around-the-clock benefits we would recommend twice a day, or alternatively as and when required.https://redsupps.co.uk/products/drip-it-cbd-oil-1-000mghttps://cdn.shopify.com/s/files/1/2544/1734/products/original-1000_1600x1600_crop_center_c6bc805d-d313-4599-86fb-eae68906b2c9_600x600_crop_center.jpg?v=1542130436CBD ASYLUM new 1580186632243in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsDRIP IT CBD OIL 69.99GBP shopify_369643290661_12933256282163Dust v2 benefitsintense pre-workout formulafive great tasting flavors descriptiondust v2 is a hardcore preworkout that greatly increases energy to improve strength, focus, and athletic performance. available in five flavors, dust v2 is sure to leave a great taste in even the most advanced gym goer's mouth.  instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/blackstone-labs-dust-v2-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/blackstone-labs-dust-v2-30-serve-pineapple-800px_600x600_crop_center.jpg?v=1542641303Blackstone Labs new 369643290661in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 29.99GBP shopify_369643290661_12933274894387Dust v2 benefitsintense pre-workout formulafive great tasting flavors descriptiondust v2 is a hardcore preworkout that greatly increases energy to improve strength, focus, and athletic performance. available in five flavors, dust v2 is sure to leave a great taste in even the most advanced gym goer's mouth.  instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/blackstone-labs-dust-v2-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/blackstone-labs-dust-v2-30-serve-pineapple-800px_600x600_crop_center.jpg?v=1542641303Blackstone Labs new 369643290661in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 29.99GBP shopify_369643290661_12933274927155Dust v2 benefitsintense pre-workout formulafive great tasting flavors descriptiondust v2 is a hardcore preworkout that greatly increases energy to improve strength, focus, and athletic performance. available in five flavors, dust v2 is sure to leave a great taste in even the most advanced gym goer's mouth.  instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/blackstone-labs-dust-v2-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/blackstone-labs-dust-v2-30-serve-pineapple-800px_600x600_crop_center.jpg?v=1542641303Blackstone Labs new 369643290661in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 29.99GBP shopify_369643290661_12933274959923Dust v2 benefitsintense pre-workout formulafive great tasting flavors descriptiondust v2 is a hardcore preworkout that greatly increases energy to improve strength, focus, and athletic performance. available in five flavors, dust v2 is sure to leave a great taste in even the most advanced gym goer's mouth.  instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/blackstone-labs-dust-v2-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/blackstone-labs-dust-v2-30-serve-pineapple-800px_600x600_crop_center.jpg?v=1542641303Blackstone Labs new 369643290661in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 29.99GBP shopify_369643290661_12933274992691Dust v2 benefitsintense pre-workout formulafive great tasting flavors descriptiondust v2 is a hardcore preworkout that greatly increases energy to improve strength, focus, and athletic performance. available in five flavors, dust v2 is sure to leave a great taste in even the most advanced gym goer's mouth.  instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/blackstone-labs-dust-v2-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/blackstone-labs-dust-v2-30-serve-pineapple-800px_600x600_crop_center.jpg?v=1542641303Blackstone Labs new 369643290661in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 29.99GBP shopify_369643290661_12933275025459Dust v2 benefitsintense pre-workout formulafive great tasting flavors descriptiondust v2 is a hardcore preworkout that greatly increases energy to improve strength, focus, and athletic performance. available in five flavors, dust v2 is sure to leave a great taste in even the most advanced gym goer's mouth.  instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/blackstone-labs-dust-v2-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/blackstone-labs-dust-v2-30-serve-pineapple-800px_600x600_crop_center.jpg?v=1542641303Blackstone Labs new 369643290661in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 29.99GBP shopify_369643290661_12933275058227Dust v2 benefitsintense pre-workout formulafive great tasting flavors descriptiondust v2 is a hardcore preworkout that greatly increases energy to improve strength, focus, and athletic performance. available in five flavors, dust v2 is sure to leave a great taste in even the most advanced gym goer's mouth.  instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/blackstone-labs-dust-v2-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/blackstone-labs-dust-v2-30-serve-pineapple-800px_600x600_crop_center.jpg?v=1542641303Blackstone Labs new 369643290661in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 29.99GBP shopify_431323021349_5034234347557Dust x dust x extreme pre-workout150mg of 2-aminoisoheptaneimproved flavoring descriptionheading into the gym you should be focused on one thing and one thing only -- complete and utter destruction of the iron. to get your mind and muscles prepared for the impending battle with the weights, you need a pre workout that emboldens you with the fire of 1,000 suns and the energy of a supernova. you need a cutting-edge pre workout that will push you to the utmost extreme and then a little more.you need dust x!dust x is the single most powerful and explosive pre workout ever formulated. each scoop delivers intense, long-lasting energy and sleeve-splitting pumps that will make you never want to leave the gym. hardcore training demands a hardcore pre workout, and for that the only option is dust x! instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/dust-extremehttps://cdn.shopify.com/s/files/1/2544/1734/products/dustX-sourgummybear_600x600_crop_center.png?v=1541096054Blackstone Labs new 431323021349in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 34.99GBP shopify_431323021349_5034234380325Dust x dust x extreme pre-workout150mg of 2-aminoisoheptaneimproved flavoring descriptionheading into the gym you should be focused on one thing and one thing only -- complete and utter destruction of the iron. to get your mind and muscles prepared for the impending battle with the weights, you need a pre workout that emboldens you with the fire of 1,000 suns and the energy of a supernova. you need a cutting-edge pre workout that will push you to the utmost extreme and then a little more.you need dust x!dust x is the single most powerful and explosive pre workout ever formulated. each scoop delivers intense, long-lasting energy and sleeve-splitting pumps that will make you never want to leave the gym. hardcore training demands a hardcore pre workout, and for that the only option is dust x! instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/dust-extremehttps://cdn.shopify.com/s/files/1/2544/1734/products/dustX-sourgummybear_600x600_crop_center.png?v=1541096054Blackstone Labs new 431323021349in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 34.99GBP shopify_431323021349_7774737268787Dust x dust x extreme pre-workout150mg of 2-aminoisoheptaneimproved flavoring descriptionheading into the gym you should be focused on one thing and one thing only -- complete and utter destruction of the iron. to get your mind and muscles prepared for the impending battle with the weights, you need a pre workout that emboldens you with the fire of 1,000 suns and the energy of a supernova. you need a cutting-edge pre workout that will push you to the utmost extreme and then a little more.you need dust x!dust x is the single most powerful and explosive pre workout ever formulated. each scoop delivers intense, long-lasting energy and sleeve-splitting pumps that will make you never want to leave the gym. hardcore training demands a hardcore pre workout, and for that the only option is dust x! instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/dust-extremehttps://cdn.shopify.com/s/files/1/2544/1734/products/dustX-sourgummybear_600x600_crop_center.png?v=1541096054Blackstone Labs new 431323021349in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 34.99GBP shopify_431323021349_12624136994867Dust x dust x extreme pre-workout150mg of 2-aminoisoheptaneimproved flavoring descriptionheading into the gym you should be focused on one thing and one thing only -- complete and utter destruction of the iron. to get your mind and muscles prepared for the impending battle with the weights, you need a pre workout that emboldens you with the fire of 1,000 suns and the energy of a supernova. you need a cutting-edge pre workout that will push you to the utmost extreme and then a little more.you need dust x!dust x is the single most powerful and explosive pre workout ever formulated. each scoop delivers intense, long-lasting energy and sleeve-splitting pumps that will make you never want to leave the gym. hardcore training demands a hardcore pre workout, and for that the only option is dust x! instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/dust-extremehttps://cdn.shopify.com/s/files/1/2544/1734/products/dustX-sourgummybear_600x600_crop_center.png?v=1541096054Blackstone Labs new 431323021349in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 34.99GBP shopify_1638355271731_15892232208435Elim1nate elite estrogen managementbalance hormones for lean muscle & fat-lossq: why is estrogen our enemy?a: estrogen can negatively affect the body in multiple ways. if your body produces too much, you experience lethargy, muscle loss, and fat gain. if you have too little you can experience joint pain and mood swings. it is this balance that we wanted to perfect with elim1nate.q: what makes elim1nate different from other anti-estrogen products?a: other products have based their claims off unreliable data and research. they rely on concepts and anecdotal data rather than proven science. pharmaceutical prescriptions also have side effects such as a negative effect on cholesterol levels. elim1nate uses natural compounds that have been shown to have multiple benefits while also suppressing the negative side effects.q: does this product only deal with estrogen?a: absolutely not! it is always our goal at olympus labs to provide customers with products that are well-rounded and can help you in different ways. elim1nate acts as a 5-in-1 natural hormone balancing supplement. it safely reduces estrogen, increases testosterone, promotes fat loss, controls the stress hormone cortisol, and prevents muscle breakdown.the best part is elim1nate can be used year-round and because it is natural, there is no need for cycling or breaks.the testosterone/estrogen balancebefore we dive into the ingredients, first we need to understand a few things. testosterone is known as the male hormone, and estrogen is known as the female hormone, however they are present in both sexes. it is this balance that is critical in maintaining your general health. too much estrogen in men and women can cause weight gain, depression, fatigue, and more serious health risks.what is aromatase?this is another key term we need to understand to better understand our bodies. in simple terms, aromatase is an enzyme. enzymes create certain reactions in the body. aromatase converts testosterone into estrogen. this is very important for both men and women. if you have too much estrogen, you don’t have enough testosterone and both sexes need a healthy balance.elimistane and pine bark: the dynamic duothe first ingredient found in elm1nate is a trademarked form of luteolin. this is a flavonoid found in many fruits and vegetables including oranges. flavanoids have been shown to play all sorts of important roles in health and are part of the reason you are always being told to eat your fruits and vegetables!luteolin acts as an aromatase inhibitor, meaning it stops that enzyme from converting testosterone to estrogen. in addition to that, it also promotes healthy cholesterol levels, healthy weight, and acts as an powerful antioxidant and anti-inflammatory. finally, luteolin prevents muscle breakdown, which is critical for anyone that is lacking in their diets.pine bark is another natural health booster that aids luteolin in blocking aromatase. by itself it is powerful, but combines with luteolin, aromatase doesn’t stand a chance! pine bark has other benefits as well. it promotes healthy blood flow and reduces inflammation while also being another powerful antioxidant. it also boosts adiponectinwhich is the hormone that supports fat burning. pine bark will increase fat burning and thermogenesis by activating brown fat cells and regulating blood glucose and insulin sensitivity.5-in-1 metabolism optimizerthe natural ingredients in elim1nate help you maintain a healthy balanced body and achieve this in five different ways. by modulating estrogen levels and in turn eliminating water retention, bloating, and fat gain you are also lowering stress levels. lowering stress promotes better dietary habits and better sleep, which in turn help optimize hormone levels. by stopping these symptoms before they start, elim1nate equips you to overcome the stressors that lead to an unhealthy lifestyle.what can’t elim1nate do?we’ve discussed several ways elim1nate can help your health but it’s also important to understand what it isn’t.does not cause weight gaindoes not harm cholesteroldoes not contain caffeinedoes not have to be cycledbut i need estrogen, right?well, kind of. the key to estrogen is management is just that: management. not elimination. elim1nate will not take your estrogen levels into dangerously low levels. this will strictly affect those with high levels of estrogen looking to bring their bodies back into balance.directions: as an adult dietary supplement, take 1 capsule 3-4 times daily with meals. do not exceed 4 capsules in a 24-hr period.https://redsupps.co.uk/products/elim1natehttps://cdn.shopify.com/s/files/1/2544/1734/products/Elim1nate_2048x_613b83d8-6281-47aa-8ba2-f5eabf8c960b_600x600_crop_center.png?v=1544871176Olympus Labs new 1638355271731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsEstrogen Blocker 29.99GBP shopify_737531723827_8790787588147Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1540372961SPARTA NUTRITION new 737531723827out of stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 53.99GBP shopify_737531723827_8790787620915Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1540372961SPARTA NUTRITION new 737531723827out of stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 53.99GBP shopify_737531723827_8790787653683Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1540372961SPARTA NUTRITION new 737531723827out of stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 53.99GBP shopify_737531723827_8790787719219Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1540372961SPARTA NUTRITION new 737531723827out of stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 53.99GBP shopify_737531723827_8790787784755Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1540372961SPARTA NUTRITION new 737531723827out of stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 53.99GBP shopify_737531723827_8790787817523Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1540372961SPARTA NUTRITION new 737531723827out of stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 53.99GBP shopify_737531723827_8790787850291Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1540372961SPARTA NUTRITION new 737531723827out of stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 53.99GBP shopify_737531723827_8790787915827Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1540372961SPARTA NUTRITION new 737531723827out of stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 53.99GBP shopify_675578871859_8238667563059Elite hardcore stack stacks automatically discounted 10% or morewhat's included?abnormalbrutal 4cechosen 1eradicategear supportmetha-quad extremepctv https://redsupps.co.uk/products/elite-hardcore-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elite-dhea_1024x_20683a86-83ef-4dee-954f-996a28dae709_600x600_crop_center.png?v=1540372962Blackstone Labs new 675578871859in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsElite HARDCORE Stack 283.99GBP shopify_1638397968435_15892363640883Endur3 product highlights:maximum level of muscle protein synthesis with 7.5g instaminos for recoveryenhances endurance for longer lasting workoutsreduces fatigue and sorenessboosts hydrationolympus labs designed the perfect peri-workout product with endur3. it remains the ultimate workout igniter to endur3 workouts of the highest intensity. because, when demigods train, it is an all-out assault on the muscles. endur3 provides a maximum level of muscle protein synthesis (mps), reduces fatigue and muscle soreness, hydrates the body as well as increasing blood flow, exercise capacity and endurance. it is a perfect and potent formula that has elevated the workouts of several demigods and demigoddesses worldwide!our customers, the demigod nation, is what motivates us to produce the most innovative and effective products on the market. apart of that effort is maintaining a dialogue with the consumer to understand their needs. we take all customer feedback and product requests seriously and try our best to make them a reality. so when we received requests from many customers for a streamlined version of endur3, we took notice. specifically, the request was for a product that could be used throughout the day or resistance training workouts. a product that still has bcaas to stimulate protein synthesis and aids muscle recovery. of course, a product that tastes delicious too! olympus labs listens to its customers and strives to meet, no—exceed, their expectations. without further ado i present endur3 bcaa.the formula is powered by the maximum mtor igniting bcaa matrix featuring 7.5g of instaminos™ bcaas in a 4:1:1 ratio; delivering 5g of leucine per dose. a high dose of leucine is by far the most effective amino acid to stimulate protein synthesis. do not be fooled by fancy ratios: if the leucine content of any product is below 5g per serving you are losing out on precious gains. with the addition of 2 grams of velositol™ we take muscle protein synthesis (mps) to another level! velositol™ increases rates of muscle protein synthesis by 25% according to research in humans.to support muscle recovery we included the fatigue destroying matrix which consists of 2g of l-glutamine, 1g of taurine and 480mg vitacherry®. it reduces reduce fatigue, cramping and can also improve endurance according to research in humans. in order to ensure you stay hydrated and further prevent muscle cramping we included the maximum hydration matrix, a combination of electrolytes.so when should you use endur3 bcaa? although endur3 bcaa has the most benefit when used immediately before, during and after workouts, that is not the only time you should use it. it can be used in-between meals to prevent muscle breakdown, when those intervals exceed 3-4 hours. in addition, supplementation with amino acids can even be beneficial on rest days or anytime where protein ingestion may be low. endur3 bcaa only contains effective ingredients at clinical doses, including three patented ingredients. do not settle for inferior products with subpar ingredients or inadequate doses. in order to re1gn inside and outside of the gym you need endur3 bcaa.directions: take 1 scoop with 10-16 ounces of water during desired exercise activity. on off days, take 1 scoop at any time with 10-16 ounces of water.https://redsupps.co.uk/products/endur3https://cdn.shopify.com/s/files/1/2544/1734/products/olypmus-labs-endur3-30-serves-dragons-mist-800px_600x600_crop_center.jpg?v=1544874850Olympus Labs new 1638397968435in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids 34.99GBP shopify_1638397968435_15892363673651Endur3 product highlights:maximum level of muscle protein synthesis with 7.5g instaminos for recoveryenhances endurance for longer lasting workoutsreduces fatigue and sorenessboosts hydrationolympus labs designed the perfect peri-workout product with endur3. it remains the ultimate workout igniter to endur3 workouts of the highest intensity. because, when demigods train, it is an all-out assault on the muscles. endur3 provides a maximum level of muscle protein synthesis (mps), reduces fatigue and muscle soreness, hydrates the body as well as increasing blood flow, exercise capacity and endurance. it is a perfect and potent formula that has elevated the workouts of several demigods and demigoddesses worldwide!our customers, the demigod nation, is what motivates us to produce the most innovative and effective products on the market. apart of that effort is maintaining a dialogue with the consumer to understand their needs. we take all customer feedback and product requests seriously and try our best to make them a reality. so when we received requests from many customers for a streamlined version of endur3, we took notice. specifically, the request was for a product that could be used throughout the day or resistance training workouts. a product that still has bcaas to stimulate protein synthesis and aids muscle recovery. of course, a product that tastes delicious too! olympus labs listens to its customers and strives to meet, no—exceed, their expectations. without further ado i present endur3 bcaa.the formula is powered by the maximum mtor igniting bcaa matrix featuring 7.5g of instaminos™ bcaas in a 4:1:1 ratio; delivering 5g of leucine per dose. a high dose of leucine is by far the most effective amino acid to stimulate protein synthesis. do not be fooled by fancy ratios: if the leucine content of any product is below 5g per serving you are losing out on precious gains. with the addition of 2 grams of velositol™ we take muscle protein synthesis (mps) to another level! velositol™ increases rates of muscle protein synthesis by 25% according to research in humans.to support muscle recovery we included the fatigue destroying matrix which consists of 2g of l-glutamine, 1g of taurine and 480mg vitacherry®. it reduces reduce fatigue, cramping and can also improve endurance according to research in humans. in order to ensure you stay hydrated and further prevent muscle cramping we included the maximum hydration matrix, a combination of electrolytes.so when should you use endur3 bcaa? although endur3 bcaa has the most benefit when used immediately before, during and after workouts, that is not the only time you should use it. it can be used in-between meals to prevent muscle breakdown, when those intervals exceed 3-4 hours. in addition, supplementation with amino acids can even be beneficial on rest days or anytime where protein ingestion may be low. endur3 bcaa only contains effective ingredients at clinical doses, including three patented ingredients. do not settle for inferior products with subpar ingredients or inadequate doses. in order to re1gn inside and outside of the gym you need endur3 bcaa.directions: take 1 scoop with 10-16 ounces of water during desired exercise activity. on off days, take 1 scoop at any time with 10-16 ounces of water.https://redsupps.co.uk/products/endur3https://cdn.shopify.com/s/files/1/2544/1734/products/olypmus-labs-endur3-30-serves-dragons-mist-800px_600x600_crop_center.jpg?v=1544874850Olympus Labs new 1638397968435in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids 34.99GBP shopify_1638397968435_15892363706419Endur3 product highlights:maximum level of muscle protein synthesis with 7.5g instaminos for recoveryenhances endurance for longer lasting workoutsreduces fatigue and sorenessboosts hydrationolympus labs designed the perfect peri-workout product with endur3. it remains the ultimate workout igniter to endur3 workouts of the highest intensity. because, when demigods train, it is an all-out assault on the muscles. endur3 provides a maximum level of muscle protein synthesis (mps), reduces fatigue and muscle soreness, hydrates the body as well as increasing blood flow, exercise capacity and endurance. it is a perfect and potent formula that has elevated the workouts of several demigods and demigoddesses worldwide!our customers, the demigod nation, is what motivates us to produce the most innovative and effective products on the market. apart of that effort is maintaining a dialogue with the consumer to understand their needs. we take all customer feedback and product requests seriously and try our best to make them a reality. so when we received requests from many customers for a streamlined version of endur3, we took notice. specifically, the request was for a product that could be used throughout the day or resistance training workouts. a product that still has bcaas to stimulate protein synthesis and aids muscle recovery. of course, a product that tastes delicious too! olympus labs listens to its customers and strives to meet, no—exceed, their expectations. without further ado i present endur3 bcaa.the formula is powered by the maximum mtor igniting bcaa matrix featuring 7.5g of instaminos™ bcaas in a 4:1:1 ratio; delivering 5g of leucine per dose. a high dose of leucine is by far the most effective amino acid to stimulate protein synthesis. do not be fooled by fancy ratios: if the leucine content of any product is below 5g per serving you are losing out on precious gains. with the addition of 2 grams of velositol™ we take muscle protein synthesis (mps) to another level! velositol™ increases rates of muscle protein synthesis by 25% according to research in humans.to support muscle recovery we included the fatigue destroying matrix which consists of 2g of l-glutamine, 1g of taurine and 480mg vitacherry®. it reduces reduce fatigue, cramping and can also improve endurance according to research in humans. in order to ensure you stay hydrated and further prevent muscle cramping we included the maximum hydration matrix, a combination of electrolytes.so when should you use endur3 bcaa? although endur3 bcaa has the most benefit when used immediately before, during and after workouts, that is not the only time you should use it. it can be used in-between meals to prevent muscle breakdown, when those intervals exceed 3-4 hours. in addition, supplementation with amino acids can even be beneficial on rest days or anytime where protein ingestion may be low. endur3 bcaa only contains effective ingredients at clinical doses, including three patented ingredients. do not settle for inferior products with subpar ingredients or inadequate doses. in order to re1gn inside and outside of the gym you need endur3 bcaa.directions: take 1 scoop with 10-16 ounces of water during desired exercise activity. on off days, take 1 scoop at any time with 10-16 ounces of water.https://redsupps.co.uk/products/endur3https://cdn.shopify.com/s/files/1/2544/1734/products/olypmus-labs-endur3-30-serves-dragons-mist-800px_600x600_crop_center.jpg?v=1544874850Olympus Labs new 1638397968435in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids 34.99GBP shopify_1638397968435_15892363739187Endur3 product highlights:maximum level of muscle protein synthesis with 7.5g instaminos for recoveryenhances endurance for longer lasting workoutsreduces fatigue and sorenessboosts hydrationolympus labs designed the perfect peri-workout product with endur3. it remains the ultimate workout igniter to endur3 workouts of the highest intensity. because, when demigods train, it is an all-out assault on the muscles. endur3 provides a maximum level of muscle protein synthesis (mps), reduces fatigue and muscle soreness, hydrates the body as well as increasing blood flow, exercise capacity and endurance. it is a perfect and potent formula that has elevated the workouts of several demigods and demigoddesses worldwide!our customers, the demigod nation, is what motivates us to produce the most innovative and effective products on the market. apart of that effort is maintaining a dialogue with the consumer to understand their needs. we take all customer feedback and product requests seriously and try our best to make them a reality. so when we received requests from many customers for a streamlined version of endur3, we took notice. specifically, the request was for a product that could be used throughout the day or resistance training workouts. a product that still has bcaas to stimulate protein synthesis and aids muscle recovery. of course, a product that tastes delicious too! olympus labs listens to its customers and strives to meet, no—exceed, their expectations. without further ado i present endur3 bcaa.the formula is powered by the maximum mtor igniting bcaa matrix featuring 7.5g of instaminos™ bcaas in a 4:1:1 ratio; delivering 5g of leucine per dose. a high dose of leucine is by far the most effective amino acid to stimulate protein synthesis. do not be fooled by fancy ratios: if the leucine content of any product is below 5g per serving you are losing out on precious gains. with the addition of 2 grams of velositol™ we take muscle protein synthesis (mps) to another level! velositol™ increases rates of muscle protein synthesis by 25% according to research in humans.to support muscle recovery we included the fatigue destroying matrix which consists of 2g of l-glutamine, 1g of taurine and 480mg vitacherry®. it reduces reduce fatigue, cramping and can also improve endurance according to research in humans. in order to ensure you stay hydrated and further prevent muscle cramping we included the maximum hydration matrix, a combination of electrolytes.so when should you use endur3 bcaa? although endur3 bcaa has the most benefit when used immediately before, during and after workouts, that is not the only time you should use it. it can be used in-between meals to prevent muscle breakdown, when those intervals exceed 3-4 hours. in addition, supplementation with amino acids can even be beneficial on rest days or anytime where protein ingestion may be low. endur3 bcaa only contains effective ingredients at clinical doses, including three patented ingredients. do not settle for inferior products with subpar ingredients or inadequate doses. in order to re1gn inside and outside of the gym you need endur3 bcaa.directions: take 1 scoop with 10-16 ounces of water during desired exercise activity. on off days, take 1 scoop at any time with 10-16 ounces of water.https://redsupps.co.uk/products/endur3https://cdn.shopify.com/s/files/1/2544/1734/products/olypmus-labs-endur3-30-serves-dragons-mist-800px_600x600_crop_center.jpg?v=1544874850Olympus Labs new 1638397968435in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids 34.99GBP shopify_1638302122035_15891962921011Enobos4rm enobos4rm (mk-2866) is the best known in a class of compounds collectively referred to as s.a.r.m.s or selective androgen receptor modulators. as the name implies s.a.r.m.s bind to the androgen receptor in a selective way similar to how a prohormone would but without the same androgenic effects common to prohormones (androgenic effects referring to the accentuation of male sex characteristics such as enhanced central nervous system firing common to all prohormones).enobos4rm therefore is an ideal candidate for a user looking for a halfway house between natural anabolics/testosterone boosters and prohormones. enobos4rm is the subject of research showing that is effects are localised in muscle tissue where it causes an increase in muscle size and strength without impacting areas such as the prostate or hairline. anecdotal feedback suggests that use of enobos4rm can translate to a muscle gains of 3-4kg of lean mass in a 4-6 week cycle while numerous studies conducted with enobos4rm support this increase in muscle and strength in studies incorporating hundreds of participants in controlled settings.without question, enobos4rm is a potent muscle and strength enhancer and aside from the anabolic effects on muscles you can also expect a mood uplift, enhanced tissue regeneration, reduction in inflammation, and increased fat loss.https://redsupps.co.uk/products/enobos4rmhttps://cdn.shopify.com/s/files/1/2544/1734/products/olympus-enobosarm_600x600_crop_center.jpg?v=1544863151Olympus Labs new 1638302122035in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsSARM 52.99GBP shopify_621486800947_7787007803443Entice her - performance for women entice her is the landmark formula to bringing a woman’s sexual experience to a new plateau. if you’re serious about upping the pleasure and intensity, entice her actively works to dramatically increase sensitivity in your areas of interest. simply take 4 capsules 15-20 minutes before engaging in sexual activity, or for a boost to your mood, take 4 capsules upon waking.men looking to enhance their sexual performance should try the male version of this product, entice her.for optimum results, couples should take these products together. prepare for the best night of your lives.https://redsupps.co.uk/products/entice-her-performance-for-womenhttps://cdn.shopify.com/s/files/1/2544/1734/products/image_3a4ce2fc-8a97-486e-b9a4-09de426da2a8_600x600_crop_center.png?v=1540372972Entice new 621486800947in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsSexual Performance Formula 32.99GBP shopify_619178197043_7775131697203Entice him - performance for men entice him is the real deal for men looking to up their game in the bedroom. reach new peaks of sexual performance and intensity with our one-of-a-kind formula. this is accomplished by increasing your own pleasure through increased sensitivity where it matters. entice him will also increase blood flow, which will lead to noticeably increased size. entice him is also a mood-enhancer, perfect for setting the mood to any encounter. simply take 2 tablets in the morning with a meal, daily.for the ladies, if you want to enhance your sexual experience, check out the female version, entice her.for optimum results, couples should take these products together. prepare for the best night of your lives.https://redsupps.co.uk/products/entice-him-performance-for-menhttps://cdn.shopify.com/s/files/1/2544/1734/products/image_a3a63159-10c7-4878-95e9-e1f0a8554701_600x600_crop_center.png?v=1540372980Entice new 619178197043in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsSexual Performance Formula 32.99GBP shopify_1638365560883_15892269793331Ep1logue turning men into demigodsthe story of (-)/- epicatechin began as a feel good story that ended in heartbreak. all over the world, bodybuilders who were expecting mythical muscle gains were instead heartbroken. a flavanol found in the cocoa plant and green tea, epicatechin, generated keen interest from the supplement industry. research in rodents suggested epicatechin demonstrated an ability to suppress a protein in the body, myostatin, which prevents the increase of muscle size and differentiation. since olympus labs is always on the leading edge of new ingredient research, we took a risk on epicatechin and released ep1c. regrettably, the majority of customers did not experience a noticeable increase in strength because it was discovered the bioavailability of the epicatechin in humans is poor.undeterred by the setback, olympus labs devoted extensive time and expense to develop a delivery system to resolve the bioavailability issue. that effort produced phytofusetm, an enhanced delivery system that research had shown could enhance the potency of epicatechin anywhere from 200 to 600%. the next chapter of epicatechin commenced with ep1c unleashed which users responded much better to and it subsequently grew in popularity. at the end of a story, however, there is an epilogue, which may further explain and in some cases provide a preview of a sequel.in this case, there is an ep1logue; simply put, it is the end of mediocrity. a new story has begun where the reputation of epicatechin will be reconstructed. olympus labs does not accept defeat because demigods can persevere through any challenge. our r&d team sought to complement epicatechin phytofusetm with innovative and effective compounds to finally establish some credibility for the ingredient. the outcome is nothing short of remarkable as ep1logue is a powerful muscle builder, an intense pump inducer, and exercise enhancer. ep1logue represents the moment where mere mortals transcend into demigods.the anchor ingredient in ep1logue is epicatechin phytofusetm.at a substantial dose of 600mg, a never before seen dose in any epicatechin product. what separates ep1logue from other epicatechin products on the market, however, is the complementary ingredients that give the epicatechin phytofusetm a turbo boost. that boost is accomplished with the addition of an ingredient we brought to the market in re1gn, vaso-6™, at 300mg. vaso-6™ is an innovative ingredient which we dubbed “super epicatechin”. it was first studied and funded through the university of south florida and it significantly increases vasodilation (it stimulates nitric oxide levels at levels 10 times greater than citrulline), stimulates blood flow, and activates muscle hypertrophy.the formula is then perfected with a new and innovative compound that, once again, olympus labs introduces to the supplement industry called urolithin b. urolithin b is an innovative ingredient with research showing that it can inhibit protein catabolism while simultaneously increase protein synthesis. urolithin b is essentially a bodybuilder’s dream; a natural ingredient that helps to build lean muscle while preventing muscle breakdown. urolithin b is more active at the androgen receptor than testosterone, and more effective than insulin when it comes to upregulating muscle protein synthesis. we included urolithin b in ep1logue at a significant dose of 150mg to serve as the perfect complement to epicatechin and vaso-6™.directions: as a dietary supplement take 2 capsules 30-45 minutes prior to working out. on off days, take 1 capsule in the morning and 1 capsule in the afternoon.https://redsupps.co.uk/products/ep1loguehttps://cdn.shopify.com/s/files/1/2544/1734/products/Ep1logue_2048x_f61a82eb-dbb9-46a2-8d63-c560199d3994_600x600_crop_center.png?v=1544871462Olympus Labs new 1638365560883in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsNatural Anabolic 42.99GBP shopify_369639129125_4714174349349Epicat benefitsexceed muscular limitdoes not require pct descriptionseveral factors impact your ability to grow muscle. most of those you can control (diet, exercise, recovery), but the biggest factor governing your ability to build massive muscles (your genetics) you have no control over...until now!epicat is a revolutionary all-natural muscle building supplement that flips the genetic switch, enabling you to become the physical freak that nature never intended. epicat isn’t a steroid, prohormone, or some other research chemical. it utilizes extracts isolated from dark chocolate and green tea to boost your anabolic potential and transform it a tower of strength and power! ingredientsgreen tea (700mg) enhances thermogenesis, metabolism, and fat oxidation resulting in greater fat burning during exercise and at rest. green tea is packed with powerful antioxidants that combat oxidative stress and promote overall health and recovery from exercise.epicatechin (300mg) significantly aids muscle growth by inhibiting myostatin, a protein present in your muscles cells that limits growth and differentiation. research shows that epicatechin stimulates release of follistatin, another protein that blocks the actions of myostatin, leading to increased exercise capacity, strength, and muscle growth. directionsas a dietary supplement, take one (1) caposule two (2) times daily with food. do not exceed two (2) capsules daily.https://redsupps.co.uk/products/blackstone-labs-epicat-60-capsules-dry-hard-gainshttps://cdn.shopify.com/s/files/1/2544/1734/products/epicat_600x600_crop_center.png?v=1540373029Blackstone Labs new 369639129125in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMyostatin Blocker 39.00GBP shopify_369643782181_4714190635045Eradicate estrogen blocker benefitsreduces estrogen levelsreduces fat storage descriptionalways feel bloated or puffy? having trouble getting those “stubborn pounds”? moody and lethargic?these are the hallmark signs of estrogen dominance in the body. with rampant estrogen production, you’ll build less muscle and store more fat -- something no man wants.it’s time to take back your manhood, and obliterate estrogen with eradicate.eradicate is a powerful suicide aromatase inhibitor (ai) that estrogen levels, promotes optimal testosterone production, and enhances sex drive. eradicate is perfect for natural and non-natural athletes looking to take control of their hormones and maximize muscle growth. ingredientsn-acetyl l-cysteine (250mg) increases production of glutathione, a powerful antioxidant that protects the liver and helps detoxify the body.safed musli (250mg) increases spermatogenesis (sperm production) and improves erectile strength. safed musli also enhances hepatic glutathione, for increased antioxidant activity, and reduces lipid peroxidation.arimistane (25mg) is a powerful aromatase inhibitor (ai) that decreases circulating levels of estrogen and cortisol in the body. arimistane acts as a suicidal ai, which prevents the conversion of testosterone to estrogen and maximizes natural testosterone production. directionsas a dietary supplement, take one (1) capsule two to three (2-3) times daily with food. due to the extreme potency, do not use for nor longer than 8 weeks without a 4 week off period. do not exceep four (4) capsules in a 24 hour period.https://redsupps.co.uk/products/blackstone-labs-eradicate-90cap-great-pct-and-on-cycle-eliminate-estro-cut-waterhttps://cdn.shopify.com/s/files/1/2544/1734/products/eradicate_d6d825a6-2d45-41b2-9e19-3ebebc0dc202_600x600_crop_center.png?v=1540373034Blackstone Labs new 369643782181in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsEstrogen Blocker 34.99GBP shopify_369636573221_4714168418341Euphoria rx key featuresenhances moodincreases sexual stimulation descriptionneed to unwind after a long, stressful day at the office? the thought of having a drink or two is intriguing, but you don’t want the inevitable hangover and sluggishness that inevitably results from a night of drinking.there must be something that helps take the edge, but doesn’t come with a laundry list of drawbacks, and blackstone labs created it in euphoria.euphoria is an all-natural, hangover free relaxation supplement that helps you unwind no matter how tightly you’ve been wound. euphoria is ideal of a chill night at home or a night out partying with friends. it’s also ideal for the more introverted folks who have a hard time cutting loose in social settings. one serving of euphoria and you’ll swear this stuff can’t be legal! it’s just that good! ingredientsbeta-phenethylamine increases levels of several “happy hormones” in the body, including dopamine and serotonin. phenylethylamine (pea) can cross the blood-brain barrier and impart a quick and powerful boost in mood and wellbeing.cdp-choline enhances production of acetylcholine (“the learning neurotransmitter”). with greater acetylcholine levels in the body, you’ll feel more focused and “with it” even after the most brain-draining day at the office..5-htp is generated tryptophan and converted to serotonin. since serotonin helps regulate behavior and mood, 5-htp may positively affect mood, appetite, and sleep.cymbidium goeringii helps the body adapt to stressful challenges such as those during intense exercise or high pressure social situations. as an adaptogen, this herb reduces mental and physical fatigue brought on by stress and promotes a sense of calm.l-theanine is a relaxing amino acid found prevalently in tea leaves. theanine is renowned for its ability to reduce stress and induce relaxation without sedation.n-acetyl l-tyrosine reduces stress by enhancing production of dopamine, epinephrine, norepinephrine. these three neurotransmitters also improve focus and alertness. directionsas a dietary supplement, take four to six (4-6) capsules on an empty stomach to assess tolerance. do not use more than one (1) bottle per day.a https://redsupps.co.uk/products/blackstone-labs-euphoria-rx-16-capsuleshttps://cdn.shopify.com/s/files/1/2544/1734/products/euphoria_061a6f05-d234-4470-ad72-04b6c8815956_600x600_crop_center.png?v=1544113795Blackstone Labs new 369636573221in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsRecreational Supplement 0.00GBP shopify_369636573221_15879371096115Euphoria rx key featuresenhances moodincreases sexual stimulation descriptionneed to unwind after a long, stressful day at the office? the thought of having a drink or two is intriguing, but you don’t want the inevitable hangover and sluggishness that inevitably results from a night of drinking.there must be something that helps take the edge, but doesn’t come with a laundry list of drawbacks, and blackstone labs created it in euphoria.euphoria is an all-natural, hangover free relaxation supplement that helps you unwind no matter how tightly you’ve been wound. euphoria is ideal of a chill night at home or a night out partying with friends. it’s also ideal for the more introverted folks who have a hard time cutting loose in social settings. one serving of euphoria and you’ll swear this stuff can’t be legal! it’s just that good! ingredientsbeta-phenethylamine increases levels of several “happy hormones” in the body, including dopamine and serotonin. phenylethylamine (pea) can cross the blood-brain barrier and impart a quick and powerful boost in mood and wellbeing.cdp-choline enhances production of acetylcholine (“the learning neurotransmitter”). with greater acetylcholine levels in the body, you’ll feel more focused and “with it” even after the most brain-draining day at the office..5-htp is generated tryptophan and converted to serotonin. since serotonin helps regulate behavior and mood, 5-htp may positively affect mood, appetite, and sleep.cymbidium goeringii helps the body adapt to stressful challenges such as those during intense exercise or high pressure social situations. as an adaptogen, this herb reduces mental and physical fatigue brought on by stress and promotes a sense of calm.l-theanine is a relaxing amino acid found prevalently in tea leaves. theanine is renowned for its ability to reduce stress and induce relaxation without sedation.n-acetyl l-tyrosine reduces stress by enhancing production of dopamine, epinephrine, norepinephrine. these three neurotransmitters also improve focus and alertness. directionsas a dietary supplement, take four to six (4-6) capsules on an empty stomach to assess tolerance. do not use more than one (1) bottle per day.a https://redsupps.co.uk/products/blackstone-labs-euphoria-rx-16-capsuleshttps://cdn.shopify.com/s/files/1/2544/1734/products/euphoria_061a6f05-d234-4470-ad72-04b6c8815956_600x600_crop_center.png?v=1544113795Blackstone Labs new 369636573221in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsRecreational Supplement 0.00GBP shopify_660703674419_8019687047219Evaporate evaporate immediate water-loss agentcompetition strength diuretic descriptionevaporate is a competition-strength diuretic designed to immediately pull a significant amount of the water out of the body. this product is not intended for prolong use and contains ten servings per bottle. ingredientsvitamin b6 (100mg) reduces built up bodily fluids due to its water retention properties. magnesium (50mg) a vital mineral that helps reduce water retention in the body. additionally, magnesium also has been shown to help provide muscular strength and can alleviate high blood pressure. taraxcum officinate extract (2000mg) acts an anti-inflammatory and reduces muscle spasms. commonly used a natural diuretic, it also has been used in herbal medicines as a mild laxative and helps improve digestion. uva ursi extract (1000mg) acts as a diuretic and contains ursolic acid, powerful astringents, and helps promote the growth of healthy new cells. it is also used to help reduce inflamation, increase urine flow, and reduce bloating and water retention. tropaeolum majus (500mg) helps to directly increase urinary flow and is also a good source of vitamin c green tea extract (300mg) enhances thermogenesis, metabolism, and fat oxidiation resulting in greater fat burning during exercise and while at rest. horsetail (250mg) increases urine production and has gained popularty as a treatment for kidney stones and uti's. taurine (150mg) helps alleviate high blood pressure, aids digestion, and helps reduce water retention and bloating. instructionsas a dietary supplement, take three (3) capsules after morning meal and three (3) capsules after mid-day meal, along with sixteen (16) ounces of water. drink at least six (6) to eight (8) 8 ounce glasses of water daily. do not exceed reccomded dose.https://redsupps.co.uk/products/evaporate-60capshttps://cdn.shopify.com/s/files/1/2544/1734/products/evaporate_600x600_crop_center.png?v=1540373041Blackstone Labs new 660703674419in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCompetition-Strength Diuretic 24.99GBP shopify_719659565107_8548550049843Eve descriptionwith evening primrose, cranberry, green tea, horsetail silica & coq10gentler and easier to swallow & absorba dietary supplementvitaminsfamily owned since 1968gmp quality assuredthese multi-vitamin softgels are easier to swallow, and are formulated for better gi tolerability. suggested usetake 3 softgels daily with food. other ingredientssoftgel capsule (gelatin, glycerin, water, carob), flax seed oil, soy lecithin and beeswax.not manufactured with wheat, gluten, milk, egg, fish or shellfish ingredients. produced in a gmp facility that processes other ingredients containing these allergens.store in a cool, dry place after opening.https://redsupps.co.uk/products/eve-180-softgelshttps://cdn.shopify.com/s/files/1/2544/1734/products/eve_600x600_crop_center.jpg?v=1540373044NOW FOODS new 719659565107in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMultivitamin 34.00GBP shopify_1496256315443_13479930986547Extreme pre-workout stack Extreme pre-workout stackstacks automatically discounted 10% or morewhat's included?dust xhype extremehttps://redsupps.co.uk/products/extreme-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dust_x_hype_extreme_600x600_crop_center.jpeg?v=1541104185Blackstone Labs new 1496256315443in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 62.99GBP shopify_1496256315443_13479931019315Extreme pre-workout stack Extreme pre-workout stackstacks automatically discounted 10% or morewhat's included?dust xhype extremehttps://redsupps.co.uk/products/extreme-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dust_x_hype_extreme_600x600_crop_center.jpeg?v=1541104185Blackstone Labs new 1496256315443in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 62.99GBP shopify_1496256315443_13479931084851Extreme pre-workout stack Extreme pre-workout stackstacks automatically discounted 10% or morewhat's included?dust xhype extremehttps://redsupps.co.uk/products/extreme-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dust_x_hype_extreme_600x600_crop_center.jpeg?v=1541104185Blackstone Labs new 1496256315443in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 62.99GBP shopify_1496256315443_13479931150387Extreme pre-workout stack Extreme pre-workout stackstacks automatically discounted 10% or morewhat's included?dust xhype extremehttps://redsupps.co.uk/products/extreme-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dust_x_hype_extreme_600x600_crop_center.jpeg?v=1541104185Blackstone Labs new 1496256315443in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 62.99GBP shopify_1496256315443_13479931215923Extreme pre-workout stack Extreme pre-workout stackstacks automatically discounted 10% or morewhat's included?dust xhype extremehttps://redsupps.co.uk/products/extreme-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dust_x_hype_extreme_600x600_crop_center.jpeg?v=1541104185Blackstone Labs new 1496256315443in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 62.99GBP shopify_1496256315443_13479931281459Extreme pre-workout stack Extreme pre-workout stackstacks automatically discounted 10% or morewhat's included?dust xhype extremehttps://redsupps.co.uk/products/extreme-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dust_x_hype_extreme_600x600_crop_center.jpeg?v=1541104185Blackstone Labs new 1496256315443in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 62.99GBP shopify_1496256315443_13479931314227Extreme pre-workout stack Extreme pre-workout stackstacks automatically discounted 10% or morewhat's included?dust xhype extremehttps://redsupps.co.uk/products/extreme-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dust_x_hype_extreme_600x600_crop_center.jpeg?v=1541104185Blackstone Labs new 1496256315443in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 62.99GBP shopify_1496256315443_13479931379763Extreme pre-workout stack Extreme pre-workout stackstacks automatically discounted 10% or morewhat's included?dust xhype extremehttps://redsupps.co.uk/products/extreme-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dust_x_hype_extreme_600x600_crop_center.jpeg?v=1541104185Blackstone Labs new 1496256315443in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 62.99GBP shopify_473665044517_5237623980069Fast food meal replacement fast food meal replacementvegetarian-friendly10 grams of plant protein descriptionask anyone who’s ever put on a lot of muscle mass, and they’ll all tell you the same thing. training is the easy part, eating all those calories is hard. whether you struggle with appetite finding time to cook (and then eat), the end result is the same -- the number on the scale doesn’t budge.blackstone labs has yet again created the ultimate supplement to help you get huge in a hurry with fast food.fast food is a meal replacement / mass gainer supplement made from 100% real food sources. there are no cheap carb sources like maltodextrin or dextrose here. each serving of fast food delivers high quality protein, carbohydrates, and fats from ingredients like organic pea protein isolate, organic brown rice protein, sweet potato, and wild yam, among others. ingredientspea protein isolate is one of the few plant-based proteins that offers a “complete” protein, thereby delivering all nine essential amino acids required for protein synthesis.brown rice protein is a plant protein that is hypoallergenic, dairy-free, and easy to digest. research notes that brown rice protein can support kidney and heart health and improve liver function.sweet potato contains high amounts of beta-carotene (vitamin a), as well as numerous other vitamins and minerals including manganese, copper, and pantothenic acid.wild yam is another starchy root vegetable, similar to sweet potato, that’s rich in complex carbohydrates, fiber, and micronutrients. oat flour provides a source of slow-digesting carbohydrates that give sustained energy. research notes that oats are rich in beta-glucan which can reduce total serum cholesterol and ldl cholesterol. mct powder contains powdered medium-chain triglycerides which provide a source of healthy fats that can be immediately used as a source of energy in the body.coconut water is rich in valuable electrolytes, such as potassium, which restore hydration and electrolyte levels following intense exercise. d-ribose combines with adenine in the body to enhance atp regeneration following exhaustive exercise, enabling you to recover faster and perform longer. instructionsas a deitary supplement, mix one (1) scoop with 6-8 oz. of water. mix thoroughly.https://redsupps.co.uk/products/fast-food-meal-replacementhttps://cdn.shopify.com/s/files/1/2544/1734/products/fastfood-candiedYams_600x600_crop_center.png?v=1540373046Blackstone Labs new 473665044517in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMeal Replacement 49.00GBP shopify_675567075379_8238563131443Fat burner stack stacks automatically discounted 10% or morewhat's included?1 trojan horse (choose flavour)1 paraburnhttps://redsupps.co.uk/products/fat-burner-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/female-male-weightloss_1024x_c93b9f40-936e-4179-8e7c-549e935be431_600x600_crop_center.png?v=1540373051Blackstone Labs new 675567075379in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsFat Burner Stack 53.99GBP shopify_675567075379_8238563164211Fat burner stack stacks automatically discounted 10% or morewhat's included?1 trojan horse (choose flavour)1 paraburnhttps://redsupps.co.uk/products/fat-burner-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/female-male-weightloss_1024x_c93b9f40-936e-4179-8e7c-549e935be431_600x600_crop_center.png?v=1540373051Blackstone Labs new 675567075379in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsFat Burner Stack 53.99GBP shopify_675567075379_15384685641779Fat burner stack stacks automatically discounted 10% or morewhat's included?1 trojan horse (choose flavour)1 paraburnhttps://redsupps.co.uk/products/fat-burner-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/female-male-weightloss_1024x_c93b9f40-936e-4179-8e7c-549e935be431_600x600_crop_center.png?v=1540373051Blackstone Labs new 675567075379in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsFat Burner Stack 53.99GBP shopify_369632870437_4714159210533Formula 19 formula-19leucine for instant anabolic effectelectrolytes for hydration and recovery descriptionformula 19 is the direct result of 19 years spent developing and perfecting the ultimate post-workout supplement. this concoction of 5 key ingredients provides the essential nutrients your body needs to recover faster, reduce soreness, and sustain your muscle pumps for hours after you’ve set down the weights.formula 19 isn’t like any other recovery supplement on the market. it uses a synergistic blend of ingredients to rapidly replenish glycogen stores, activate protein synthesis, and halt muscle breakdown. formula 19 isn’t just another post workout supplement, it’s the post-workout supplement. ingredientsr3 carbohydrate blend (25g) contains a scientific blend of three rapidly digesting carbohydrates but without the unwanted insulin spike. the r3 carbohydrate formula is quickly absorbed, meaning no “heavy feeling” during training, making it the ultimate pre and post workout fuel.l-glutamine (4.5g) is an amino acid lost in substantial quantities during intense exercise. glutamine is essential to recovery following strenuous physical activity and immune system function. it also helps conserve lean muscle mass by preventing catabolism.l-leucine (2.5g) is one of the three branched chain amino acids (bcaas) and primary activator of mtor. leucine induces muscle protein synthesis, which supports muscle growth and prevents catabolism.magnesium glycyl glutamine (500mg) is stabilized glutamine in the world, protected by an exclusive patent. this form of glutamine offers enhanced bioavailability and ensures safe passage through the tortuous gi system. alpha lipoic acid (100mg) improves the body’s ability to absorb and convert sugar to energy, making it ideal to take with carbohydrates. alpha lipoic acid (ala) acts as an “insulin-mimetic) and shuttle the carbohydrates contained in formula 19, along with all the other nutrients here, directly into your muscles for maximum effectiveness. instructionsfor men: as a dietary supplement, mix two (2) scoops in 8-10 oz. of water and take post-workout on training days.for women: as a dietary supplement, mix two (1) scoops in 8-10 oz. of water and take post-workout on training days. https://redsupps.co.uk/products/blackstone-labs-formula-19https://cdn.shopify.com/s/files/1/2544/1734/products/formula19-fruitpunch_600x600_crop_center.png?v=1540373052Blackstone Labs new 369632870437in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPost Workout Formula 29.99GBP shopify_369632870437_4714159243301Formula 19 formula-19leucine for instant anabolic effectelectrolytes for hydration and recovery descriptionformula 19 is the direct result of 19 years spent developing and perfecting the ultimate post-workout supplement. this concoction of 5 key ingredients provides the essential nutrients your body needs to recover faster, reduce soreness, and sustain your muscle pumps for hours after you’ve set down the weights.formula 19 isn’t like any other recovery supplement on the market. it uses a synergistic blend of ingredients to rapidly replenish glycogen stores, activate protein synthesis, and halt muscle breakdown. formula 19 isn’t just another post workout supplement, it’s the post-workout supplement. ingredientsr3 carbohydrate blend (25g) contains a scientific blend of three rapidly digesting carbohydrates but without the unwanted insulin spike. the r3 carbohydrate formula is quickly absorbed, meaning no “heavy feeling” during training, making it the ultimate pre and post workout fuel.l-glutamine (4.5g) is an amino acid lost in substantial quantities during intense exercise. glutamine is essential to recovery following strenuous physical activity and immune system function. it also helps conserve lean muscle mass by preventing catabolism.l-leucine (2.5g) is one of the three branched chain amino acids (bcaas) and primary activator of mtor. leucine induces muscle protein synthesis, which supports muscle growth and prevents catabolism.magnesium glycyl glutamine (500mg) is stabilized glutamine in the world, protected by an exclusive patent. this form of glutamine offers enhanced bioavailability and ensures safe passage through the tortuous gi system. alpha lipoic acid (100mg) improves the body’s ability to absorb and convert sugar to energy, making it ideal to take with carbohydrates. alpha lipoic acid (ala) acts as an “insulin-mimetic) and shuttle the carbohydrates contained in formula 19, along with all the other nutrients here, directly into your muscles for maximum effectiveness. instructionsfor men: as a dietary supplement, mix two (2) scoops in 8-10 oz. of water and take post-workout on training days.for women: as a dietary supplement, mix two (1) scoops in 8-10 oz. of water and take post-workout on training days. https://redsupps.co.uk/products/blackstone-labs-formula-19https://cdn.shopify.com/s/files/1/2544/1734/products/formula19-fruitpunch_600x600_crop_center.png?v=1540373052Blackstone Labs new 369632870437in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPost Workout Formula 29.99GBP shopify_369632870437_4714159276069Formula 19 formula-19leucine for instant anabolic effectelectrolytes for hydration and recovery descriptionformula 19 is the direct result of 19 years spent developing and perfecting the ultimate post-workout supplement. this concoction of 5 key ingredients provides the essential nutrients your body needs to recover faster, reduce soreness, and sustain your muscle pumps for hours after you’ve set down the weights.formula 19 isn’t like any other recovery supplement on the market. it uses a synergistic blend of ingredients to rapidly replenish glycogen stores, activate protein synthesis, and halt muscle breakdown. formula 19 isn’t just another post workout supplement, it’s the post-workout supplement. ingredientsr3 carbohydrate blend (25g) contains a scientific blend of three rapidly digesting carbohydrates but without the unwanted insulin spike. the r3 carbohydrate formula is quickly absorbed, meaning no “heavy feeling” during training, making it the ultimate pre and post workout fuel.l-glutamine (4.5g) is an amino acid lost in substantial quantities during intense exercise. glutamine is essential to recovery following strenuous physical activity and immune system function. it also helps conserve lean muscle mass by preventing catabolism.l-leucine (2.5g) is one of the three branched chain amino acids (bcaas) and primary activator of mtor. leucine induces muscle protein synthesis, which supports muscle growth and prevents catabolism.magnesium glycyl glutamine (500mg) is stabilized glutamine in the world, protected by an exclusive patent. this form of glutamine offers enhanced bioavailability and ensures safe passage through the tortuous gi system. alpha lipoic acid (100mg) improves the body’s ability to absorb and convert sugar to energy, making it ideal to take with carbohydrates. alpha lipoic acid (ala) acts as an “insulin-mimetic) and shuttle the carbohydrates contained in formula 19, along with all the other nutrients here, directly into your muscles for maximum effectiveness. instructionsfor men: as a dietary supplement, mix two (2) scoops in 8-10 oz. of water and take post-workout on training days.for women: as a dietary supplement, mix two (1) scoops in 8-10 oz. of water and take post-workout on training days. https://redsupps.co.uk/products/blackstone-labs-formula-19https://cdn.shopify.com/s/files/1/2544/1734/products/formula19-fruitpunch_600x600_crop_center.png?v=1540373052Blackstone Labs new 369632870437in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPost Workout Formula 29.99GBP shopify_735351930931_8753129914419Gains stack stacks automatically discounted 10% or morewhat's included?maniacontraa simple yet highly effective stack for men seeking lean muscle, strength and overall performance gains while activating your metabolism. get your body composition on the right track and increase your vascularity, get solid muscles and elevate your muscular / sexual stamina. note: use stack 4-8 weeks. no 'on cycle support' is required.https://redsupps.co.uk/products/gains-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/CONTRA-AND-MANIA-STACK_1024x_84084182-319b-40d5-851d-64fb37bf1cbe_600x600_crop_center.jpg?v=1540373062MYOBLOX new 735351930931in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsGAINS STACK 74.99GBP shopify_369641521189_4714183950373Gear support gear support protects your organstake alongside intense products descriptionrunning a cycle of potent muscle-building compounds can bring some of the greatest gains you’ve ever experienced. but with those big gains comes some big risks that if you’re not prepared for, can leave you broken, beaten, and bleeding.don’t fret as blackstone labs has you covered with gear support.gear support is a robust and comprehensive cycle support supplement to be used anytime you’re running an aggressive supplement cycle. gear support provides the essential nutrients your vital organs need to protect, detoxify, and purify them while on cycle. ingredientsn-acetyl l-cysteine (400mg) is a powerful antioxidant that eliminates free radicals and neutralizes toxins. as a precursor to glutathione (another powerful antioxidant), n-acetyl l-cysteine promotes liver health and supports immune system functionhawthorne berry (300mg) dilates the coronary arteries, improving blood and oxygen supply to the heart. hawthorne berry also strengthens the heart's pumping ability, aiding cardiovascular function and efficiency.red clover (100mg) supports cardiovascular healthy by improving blood circulation and increasing hdl (“good”) cholesterol. red clover is believed to “purify” the blood since it exerts a diuretic-like effect in the body.celery extract 4:1 (75mg) combats high blood pressure (hypertension) and offers some measure of liver protection due to its high phthalide content. phthalides are volatile compounds present in celery responsible for the extract's efficacy.grape seed extract (75mg) protects cells from free radical damage due to its high antioxidant and polyphenol content. research also demonstrates that grape seed extract supports cardiovascular health by improving circulation. instructionsas a dietary supplement, take one (1) capsule one to two (1-2) times daily with food. do not exceed two (2) capsules daily.https://redsupps.co.uk/products/blackstone-labs-gear-support-90cap-complete-on-and-post-cycle-ph-saa-supporthttps://cdn.shopify.com/s/files/1/2544/1734/products/gearsupport_600x600_crop_center.png?v=1540373063Blackstone Labs new 369641521189in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCycle Support 27.99GBP shopify_369643847717_4714190700581Glycolog glycologmaximizes insulin utilizationimproves glucose metabolism descriptioncarbs have gotten a pretty bad rap in recent years. they’ve become outcasts, shunned by everyone from celebrities to soccer moms and even high-level athletes, who need them more than anyone else!carbs have been painted as disgusting little vermin that do nothing but make you fat, lazy, and disgusting. the reason is that eating carbs increase insulin, the body’s storage hormone. insulin can either shuttle carbs into fat or muscle depending on your genetics, and for most individuals, they have poor genetics, which means eating carbs inevitably leads to increased fat.that’s where glycolog comes in. it hacks your genetic code to make insulin work for you, not against you. glycolog acts as a nutrient partitioner, directs those carbs you eat into your muscles and not your adipose tissue.using glycolog means carbs are back on the menu again, and they’re bringing some serious lean gains with them! ingredientsgymnema sylvestre (1g) enhances insulin function to reduce blood sugar. a comprehensive review of the scientific literature on gymnema sylvestre notes it also reduces plasma glucose, leptin levels, body weight, and even body mass index (bmi).[bitter melon (500mg) increases glucose uptake and utilization by skeletal muscles as well as reduces formation of glycogen in the liver. additional research on bitter melon notes in also suppresses inflammation in adipose tissue (fat).super berberine (300mg) lowers blood glucose levels and encourages glucose absorption by muscle cells. glycolog includes the trademarked super berberine for its improved bioavailability over standard berberine supplements.cinnamon bark (250mg) increases insulin activity while simultaneously acting as an insulin mimetic to facilitate glucose transport into skeletal muscle tissue. cinnamon bark reduces blood sugar, cuts body fat, and increases lean mass.sodium r-lipoate (150mg) is a highly bioavailable form of alpha lipoic acid (ala). ala is essential to carbohydrate metabolism and also acts as a powerful antioxidant in the body. it helps lower blood sugar, reduce appetite, and increase energy expenditure.bioperine (5mg) can enhance the effectiveness of the blood sugar-lowering compounds in glycolog by increasing the time they remain active in the bloodstream.chromium (300mcg) is an essential mineral that helps regulate blood glucose. chromium is critical to insulin metabolism and therefore a vital component to nutrient uptake in the body. directionsas a dietary supplement, take three (3) capsules with a high-carb meal two (2) times per day. do not exceed six (6) capsules daily.https://redsupps.co.uk/products/blackstone-labs-glycolog-180caps-extreme-slin-mimetic-get-huge-quickhttps://cdn.shopify.com/s/files/1/2544/1734/products/glycolog_600x600_crop_center.png?v=1540373068Blackstone Labs new 369643847717in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsNutrient Partitioning Agent 39.00GBP shopify_369641488421_4714183917605Growth key featurespost workout recoveryburn calories while sleeping descriptionmuscle growth -- it’s whatever athlete desires from a life spent lifting heavy. one of the biggest contributors to muscle growth is a little hormone called hgh, human growth hormone. this hormone stimulates growth, cell reproduction, and cell regeneration in humans. unfortunately, using exogenous hgh is highly illegal and can come with serious side effects.however, there is an all-natural way to stimulate greater hgh release in the body and blackstone labs has come up with the ultimate hgh-boosting formula in growth.growth is a superior all-natural way to boost growth hormone release and get a better night’s sleep for superhuman muscle building and recovery. instructionsas a dietary supplement, take three (3) capsules 30 minutes before bed. do not exceed three (3) capsules daily.https://redsupps.co.uk/products/blackstone-labs-growth-90caps-helps-to-recover-get-leaner-grow-more-stay-younghttps://cdn.shopify.com/s/files/1/2544/1734/products/growth_600x600_crop_center.png?v=1541510980Blackstone Labs new 369641488421in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsGH Booster 29.99GBP shopify_1488877191219_13401310429235Gutright descriptionmodbiotictm is a unique complex of polyphenols, polysaccharides, glucans, lectins and other compounds that modulate microbes toward an anti-inflammatory and anti-obesity profile through combinations of antibacterial, antifungal and anti-parasitic actions that reduce excessive firmicutes and increase deficient bacteroidetes.gutright™– modbiotic™(4 pillars of health)gutrighttm is here because our health has declined;globally our health has declined significantly in the last 50 years with the following epidemics;obesitydiabetes type 2, metabolic syndrome/insulin resistant syndrome and poly cystic ovarian syndrome (pcos)autism and attention deficit hyperactivity disorder (adhd)anxiety and depressiongut problems – inflammatory bowel disease (ibd) / irritable bowel syndrome (ibs) / small intestine bowel overgrowth (sibo) / fermentable oligo- di- and monosaccharides and polyols (fodmap) / indigestion / reflux (gord)immune dysregulation – allergies, resistant infections, and autoimmunitycardiovascular diseasebut, we have hardly changed in that time!that is not enough time for us to have evolved new genes and new genetic material across our species to explain our bad health. it is not human genetic polymorphisms and gene defects.our total calories in versus calories out have not changed enough to explain the above epidemics.so, what has changed?our gut bugs have changed because our food and eating has changed.we have two genomes, one inherited from our parents and the other acquired from our microbiome. our inherited genome from our parents takes so many generations to change. mathematical models suggest we have the ability to change 0.05% of our genetic material over 100,000 years. on average, in dna sequence, each human is 99.5% similar to any other human.  while our inherited genome hardly changes if at all during our lifetime, the microbiome genome is extremely dynamic and can be constantly changing, even from night and day. the human gut microbiome accounts for more than 5 million different genes that is 100 x the number of genes we possess. some of the genes encoded by the human core microbiome build systems required for their human host survival, but not present in our human genome. our gut microbiota consists of more than 10 trillion microbial cells, which is about 10x the number of our own cells making up about 1–2 kg of our body weight. our gut bugs play a very active role in our energy metabolism and immune and inflammatory systems.there is a common link between the above epidemics, a particular change in our gut flora driving these diseases. there are more than 1000 microbial strains but 90% of the biomass consists of firmicutes and bacteroidetes.  the ratios between the firmicutes and bacteroidetes will determine your metabolic rate and the degree of inflammation your body experiences and this can be the difference between winning and losing in life.too many “firmicute” bacteriafirmicutes are sugar feeders that create inflammation and slow our metabolismnot enough “bacteroidetes” bacteriabacteroidetes bacteria are fat feeders that block inflammation and boost our metabolismthis imbalance has been discovered in humans and in animal models.studies are showing a reduction in bacteroidetes together with a proportional increase in the firmicutes in obese mice, compared with their controls, when consuming exactly the same diet and performing the same exercise. showing that subjects with obesity and metabolic syndrome and those with more severe complications of obesity have the greatest imbalance in their gut microbiota.further testing has revealed a reduced abundance of intestinal bacteroidetes and an increased abundance of firmicutes was also observed in obese humans.the figure below shows the changing microbiome in lean subjects to obese subjects. as the body mass index (bmi) increases indicating an increase in body weight to obesity, the relative abundance of firmicutes compared to bacteroidetes in the gut microbiota continues to rise.figure 1 the relative abundance of the major microbial phyla in different bmi categories (a bmi < 18.5, b bmi 18.5–24.9, c bmi 25–29.9 and d bmi ≥30)a study conducted in obese and lean twins also showed that firmicutes were dominant in the obese twins and that bacteroidetes were dominant in the lean twins. they also observed that the abundant bacteroidetes enhances the genes linked to carbohydrate metabolism. meaning the bacteroidetes enhanced the lean subject’s ability to burn carbohydrate as fuel instead of storing as fat.it is not us that is changing. our gut bugs are changing as our food changes; we are not adapting fast enough. hence, the current health crisis.what made our gut bugs change?our eating has changed & our food has changedour food has changed due to farming techniques, harvesting, storage and food preparation techniques along with our food choices and purchases.per gram of fruit, vegetables, nuts, seeds, and grains we now havemore sugarless fiberless antimicrobial, antibacterial and antifungal compounds from fiber, pulp, skins, peels, and seedsplus “added” round-upless micronutrientswe eat a “balanced” diet but not a varied dietwe eat the same food all year round and we don’t eat with seasons. in nature, we would cycle between different fruits, vegetables, nuts, seeds, legumes and grains through the seasons. eating what is fresh and available for the season and then having months off while we wait for that season return. we have been taught to have a balanced diet by balancing our food groups in each meal or day but we tend to select the same foods, our favorite foods to consume most days, all year round.we do not have regular intermittent fasting. in nature we go through phases of feast and famine, our metabolism learns to adapt to changing ratios of protein, carbohydrates, and fats and eating at different times of the day.without this variation and change, there is a constant food supply for certain microorganisms and deficiencies of favorite foods for other microbes and that will fuel an overgrowth of some and deficiencies of others. we need variety.so, how do we fix it?probiotics?no. we have too many bugs and most probiotic supplements are actually firmicutes e.g. lactobacillus is a firmicute!  using probiotics to fix overgrowth of bad bugs is like throwing grass seeds at weeds. they do not get rid of established bad bugs and usually just add more firmicutes.prebiotics?no. we already have too much sugar in our food, they are already eating that. why add a capsule more? prebiotics are just food for bugs, do you want to feed your weeds? if probiotics are like throwing grass seeds at weeds than prebiotics are like throwing fertilizer on weeds.symbiotics?no. that just combines the above 2 points.modbiotictm?yes!!!modbiotictm can reduce the bad firmicutes and increase the good bacteroidetes.modbiotictm includes antimicrobial, antifungal, antibacterial compounds such as polyphenols, polysaccharides, glucans and other compounds that control growth and ratios of gut flora. modbiotictm can reduce “bad” bugs and increase “good” bugs.modbiotictm contains ingredients found in the skin, peel, seeds, shoots, outer leaves, pulp and fiber of our foods but they have disappeared.recent independent research shows supplementation with polyphenols in obese individuals along with a probiotic restricted diet; including low amounts of probiotic-rich foodstuffs like yogurt, soy yogurt, or as probiotic supplements are the most effective way to change the gut microbiome to correct obesity.you can replace these missing nutrients by supplementing with gutright tm – modbiotic ™what is “modbiotictm”?modbiotictm is a unique complex of polyphenols, polysaccharides, glucans, lectins and other compounds that modulate microbes toward an anti-inflammatory and anti-obesity profile through combinations of antibacterial, antifungal and antiparasitic actions that reduce excessive firmicutes and increase deficient bacteroidetes.gutright™ by atp science is an evolutionary step in healthcare using all of the most recent scientific findings and discoveries and a step back in time to before modern man and science intervened with nature’s plan. after hundreds of years of research into the gut and its governing role over so many other systems in the human body and overall health, we have gone full circle to realize the man’s best efforts and genius does not come close to the intricacies of synergy and the intelligence that nature possesses.the good news is that we do not need a time machine. it is not too late. we can compensate and replace the missing modbiotic compounds by fortifying our diets with atp science gutright™ modbiotic™what will gutrighttm do for me?will modulate gut bug ratios dysbiosis, sibo, leaky gut wall, allergies, and intolerancessupport immuneaid liver and detoxification pathwaysreduce inflammationreduce insulin resistancesupport healthy metabolismprevent and correct fatigue disorderseliminate brain fog and aid mental clarityimprove physical and mental performancecorrect firmicute: bacteroidetes (kill of excess firmicute and increase deficient bacteroidetes)kill off candida (yeasts, fungi, and moulds)displace parasitesgutrighttm protocolmodbiotictm modifies ratios of microorganisms in your gut by reducing the excessive organisms that have overgrown and supporting the deficient strains to grow.high doses of modbiotictm can be used in the short term to purge the overgrowth and lower doses have a more modulating effect over a longer period of time to maintain the healthier ratios.short term kickstartdo this to start your gutrighttm journey or again after events that may disrupt your healthy balance of gut flora for example after antibiotics, food poisoning, colds, cases of flu or allergies, bad eating and binging.take 1 teaspoon of gutrighttm mixed into water, juice, smoothie, nowaytm protein powder or honey 3 times daily with meals for 10 days whilst following the specific carbohydrate diet.what to expect:this will be directly proportional to what is living inside you and what it smells and sounds like as it leaves you.the herxheimer reaction is a die-off reaction, the more bad bugs you have to kill the more toxins are released, some people may experience burping, farting, gurgling, nausea.this product is not a laxative style purgative. it will not induce explosive diarrhea or leakage. the purging effect comes from the removal of excessive organisms and how they try to fight back.days 1 to 3:in most cases, the first 3 days will see a die-off of the excessive microbes and removal of old waste and this will build up a certain amount of gases and short chain fatty acids and putrefied and degraded material being eliminated in the stool. by day 3 you may suspect that something has died inside of you or possibly something dead was put inside you while you were sleeping.common feedback at this point;“that wasn’t me, that doesn’t smell like one of mine”“that was the dog”“sorry”“don’t go in that room”days 3 to 7:at this point, the amount of dead microbes in your stool is significantly increasing adding to the size and volume of fecal matter created. the changing mucosa and short chain fatty acids and fiber in stools may also be increasing adding to the bulk of the stool and improving the bowel as a muscle.at this point and typically peaking on day 5; you are making lots of poop. you may do lots of pooping on these days but form should be good and comfortable, the smell should be starting to improve and on day 5 expect the poop of 5 people to be leaving you.common feedback at this point is;“where is my phone i need something to read”“i need to poop again”“holy dunny choker, i need a wire coat hanger and multiple flushing”“why does it take so long for the toilet to refill to flush again?”days 7 to 10:most of the die-off has occurred, most of the elimination of excessive waste has been purged. modulating strains and ratios are starting to control populations. guts are feeling right.you are now ready to maintainlong-term maintenance:take 1 teaspoon of gutrighttm mixed into water, juice, smoothie, nowaytm protein powder or honey daily. (at night is best as normal transit time will be about 10 hours which will mean you are regular each morning but everyone can work out their own way)the 4 pillars of health – #01: gutrighttm.there is a hierarchy of health. before you can force things to change you must first ensure that change is possible by building a solid base foundation to work from. an adequate supply of essential nutrients and the ability to digest, absorb and utilize these nutrients are the basis of our 4 pillars of health.once we ensure we are capable of achieving and maintaining health with the 4 pillars we can force change with other dynamic formulations used as short-term tools to correct imbalances. https://redsupps.co.uk/products/gutrighthttps://cdn.shopify.com/s/files/1/2544/1734/products/gutright-front_600x600_crop_center.jpg?v=1540568613ATP Science new 1488877191219in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsModbiotic Formula 39.99GBP shopify_1624874549299_15851306090547Half gallon jug Description- 1/2 gallon liquid capacity- larger lid for easy cleaninghttps://redsupps.co.uk/products/half-gallon-jughttps://cdn.shopify.com/s/files/1/2544/1734/products/myoblox_jug_600x600_crop_center.jpg?v=1544107235MYOBLOX new 1624874549299in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsHALF GALLON JUG 9.99GBP shopify_1622597435443_15838147510323Halo elite Key features:100% natural plant androgenbuilds incredible size and strengthaggression in the gym (towards weights)safe for women descriptionblackstone labs has done it again with its re-launch of halo elite, which is the first plant androgen (phytoandrogen) ever developed and sold in ethical doses. phytoandrogens are substances produced in plants which have effects similar to testosterone, which regulates the development and maintenance of male characteristics by binding to androgen receptors. blackstone labs has found such an androgen in the plant eucommia ulmoides which causes skeletal muscle development, bone density improvement, and increases in sex drive.plants containing compounds such as the isoflavonoids, with female hormone-like effects that bind to human estrogen receptors, have been known for decades. eucommia ulmoides is the first to have corresponding male hormone-like effects that interact with the human androgen receptor. blackstone labs' halo elite that contains a proprietary 100:1 extract (andro 100) from the tree bark of eucommia ulmoides and possesses bimodal phytoandrogenic and hormone potentiating effects by other lipidic components. ingredientseucommia ulmoides: a proprietary 100:1 extract (andro 100) from the tree bark of eucommia ulmoides possesses bimodal phytoandrogenic and hormone potentiating effects by other lipidic components. eucommia ulmoides causes skeletal muscle development, bone density improvement, and increases in sex drive.https://redsupps.co.uk/products/halo-elitehttps://cdn.shopify.com/s/files/1/2544/1734/products/haloelite_2000x_865009da-7e00-48d3-9a3a-2f3e645da66a_600x600_crop_center.jpg?v=1544004942Blackstone Labs new 1622597435443in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPlant Androgen 34.99GBP shopify_675577364531_8238649671731Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1540373090Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649704499Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1540373090Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649737267Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1540373090Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649770035Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1540373090Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649802803Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1540373090Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649835571Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1540373090Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649868339Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1540373090Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649901107Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1540373090Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649933875Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1540373090Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649966643Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1540373090Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649999411Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1540373090Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238650032179Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1540373090Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238650064947Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1540373090Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238650097715Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1540373090Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238650130483Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1540373090Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238650163251Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1540373090Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_551826948147_7270253789235Hormone-free stack stacks automatically discounted 10% or morewhat's included?anogeninepicatgrowthhttps://redsupps.co.uk/products/natural-mass-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/natural-mass_480x_b93a38cd-0128-468f-a33a-5b33b05d3029_600x600_crop_center.png?v=1540373092Blackstone Labs new 551826948147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsNatural Mass Stack 96.99GBP shopify_691177619507_8412863561779Hormone-free stack plus stacks automatically discounted 10% or morewhat's included?anogeninepicatgrowthrecomp rxhttps://redsupps.co.uk/products/hormone-free-stack-plushttps://cdn.shopify.com/s/files/1/2544/1734/products/natural-mass-plus_1024x_77eebb30-1534-45eb-a916-6271f8a163ff_600x600_crop_center.png?v=1540373094Blackstone Labs new 691177619507in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsHormone-Free Stack Plus 133.99GBP shopify_733996941363_8712674672691Hydra8 bcaa  descriptionan extremely popular category of sports nutrition products, amino acids have become a far-cry of their main purpose of supplementation: muscle growth and recovery.supplement companies now focus solely on flavouring and cut down on the amount of amino acids, mainly leucine, in order to offer the best flavouring, quickly. rather than spend months in r&d testing and crafting a flavour profile that doesn’t have to skimp on quality, many just cut down on dosages and use run-of-the-mill flavors, such as fruit punch, to quickly launch their amino acid powder.at sparta nutrition, we’ve carefully crafted hydra8 bcaa to be the leading choice when it comes to intra or post-workout nutrition for those looking to maximise their muscle recovery from intense, gruelling training sessions. perfect for endurance athletes, bodybuilders, and even crossfit athletes, hydra8 bcaa is an expertly dosed bcaa powder supplement combined with a unique energy complex designed to give you a much needed pick-me-up while you train and fatigue.  not only does hydra8 bcaa offer bcaa’s & an energy complex, it also contains l-glutamine, a very well known conditionally essential amino acid that offers incredible synergy with bcaa’s to even further maximise your recovery.https://redsupps.co.uk/products/hydra8-bcaahttps://cdn.shopify.com/s/files/1/2544/1734/products/hydra_green_apple_1_1_600x600_crop_center.png?v=1540373098SPARTA NUTRITION new 733996941363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids & Energy 27.99GBP shopify_733996941363_8712674705459Hydra8 bcaa  descriptionan extremely popular category of sports nutrition products, amino acids have become a far-cry of their main purpose of supplementation: muscle growth and recovery.supplement companies now focus solely on flavouring and cut down on the amount of amino acids, mainly leucine, in order to offer the best flavouring, quickly. rather than spend months in r&d testing and crafting a flavour profile that doesn’t have to skimp on quality, many just cut down on dosages and use run-of-the-mill flavors, such as fruit punch, to quickly launch their amino acid powder.at sparta nutrition, we’ve carefully crafted hydra8 bcaa to be the leading choice when it comes to intra or post-workout nutrition for those looking to maximise their muscle recovery from intense, gruelling training sessions. perfect for endurance athletes, bodybuilders, and even crossfit athletes, hydra8 bcaa is an expertly dosed bcaa powder supplement combined with a unique energy complex designed to give you a much needed pick-me-up while you train and fatigue.  not only does hydra8 bcaa offer bcaa’s & an energy complex, it also contains l-glutamine, a very well known conditionally essential amino acid that offers incredible synergy with bcaa’s to even further maximise your recovery.https://redsupps.co.uk/products/hydra8-bcaahttps://cdn.shopify.com/s/files/1/2544/1734/products/hydra_green_apple_1_1_600x600_crop_center.png?v=1540373098SPARTA NUTRITION new 733996941363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids & Energy 27.99GBP shopify_733996941363_12968859861043Hydra8 bcaa  descriptionan extremely popular category of sports nutrition products, amino acids have become a far-cry of their main purpose of supplementation: muscle growth and recovery.supplement companies now focus solely on flavouring and cut down on the amount of amino acids, mainly leucine, in order to offer the best flavouring, quickly. rather than spend months in r&d testing and crafting a flavour profile that doesn’t have to skimp on quality, many just cut down on dosages and use run-of-the-mill flavors, such as fruit punch, to quickly launch their amino acid powder.at sparta nutrition, we’ve carefully crafted hydra8 bcaa to be the leading choice when it comes to intra or post-workout nutrition for those looking to maximise their muscle recovery from intense, gruelling training sessions. perfect for endurance athletes, bodybuilders, and even crossfit athletes, hydra8 bcaa is an expertly dosed bcaa powder supplement combined with a unique energy complex designed to give you a much needed pick-me-up while you train and fatigue.  not only does hydra8 bcaa offer bcaa’s & an energy complex, it also contains l-glutamine, a very well known conditionally essential amino acid that offers incredible synergy with bcaa’s to even further maximise your recovery.https://redsupps.co.uk/products/hydra8-bcaahttps://cdn.shopify.com/s/files/1/2544/1734/products/hydra_green_apple_1_1_600x600_crop_center.png?v=1540373098SPARTA NUTRITION new 733996941363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids & Energy 27.99GBP shopify_733996941363_12968984182835Hydra8 bcaa  descriptionan extremely popular category of sports nutrition products, amino acids have become a far-cry of their main purpose of supplementation: muscle growth and recovery.supplement companies now focus solely on flavouring and cut down on the amount of amino acids, mainly leucine, in order to offer the best flavouring, quickly. rather than spend months in r&d testing and crafting a flavour profile that doesn’t have to skimp on quality, many just cut down on dosages and use run-of-the-mill flavors, such as fruit punch, to quickly launch their amino acid powder.at sparta nutrition, we’ve carefully crafted hydra8 bcaa to be the leading choice when it comes to intra or post-workout nutrition for those looking to maximise their muscle recovery from intense, gruelling training sessions. perfect for endurance athletes, bodybuilders, and even crossfit athletes, hydra8 bcaa is an expertly dosed bcaa powder supplement combined with a unique energy complex designed to give you a much needed pick-me-up while you train and fatigue.  not only does hydra8 bcaa offer bcaa’s & an energy complex, it also contains l-glutamine, a very well known conditionally essential amino acid that offers incredible synergy with bcaa’s to even further maximise your recovery.https://redsupps.co.uk/products/hydra8-bcaahttps://cdn.shopify.com/s/files/1/2544/1734/products/hydra_green_apple_1_1_600x600_crop_center.png?v=1540373098SPARTA NUTRITION new 733996941363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids & Energy 27.99GBP shopify_733877665843_8707321462835Hydrashred  descriptionlosing weight, getting shredded, and the pursuit of dropping body fat can be amongst the most arduous of tasks out there. if you've ever done cardio, you know that each and every minute is feels like eternity. it's time to capitalize and utilize the most advanced premium ultra strength lipolytic fat burner available: hydrashred.featuring premium dosages of garcinia cambogia extract, 6 different types of caffeine, ultra-powerful stimulants, grains of paradise, acetyl-l-carnitine, banaba leaf, l-carnitine-l-tartrate, and more, it just doesn't get better. burn fat, shape your physique, reduce your appetite, and increase energy now.hydrashred tablets feature dual release technology, which simply means that each and every single tablet has two parts: instant release and 6-hour time release. this way you're effectively getting the actives released throughout your body throughout the day. [this differs from the hydrashred powder which hits immediately].https://redsupps.co.uk/products/hydra-shredhttps://cdn.shopify.com/s/files/1/2544/1734/products/hydra_shred_tabs_1_600x600_crop_center.png?v=1540373173SPARTA NUTRITION new 733877665843in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsFat Burner 29.00GBP shopify_733883760691_8707544383539Hydrashred powder  descriptionlosing weight, getting shredded, and the endless pursuit of dropping stubborn body fat can be amongst the most arduous of tasks out there.if you've ever done cardio, you know that each and every minute feels like an eternity. it's time to capitalize and utilize the most advanced lipolytic thermogenic fat burner available designed to torch fat deposits off your midsection and love handles: hydrashred.featuring scientifically validated dosages of key weight loss ingredients such as garcinia cambogia & green coffee bean extract, grains of paradise, banaba leaf, l-carnitine-l-tartrate, and a unique never-before-seen neurosensory blend featuring 6 different types of caffeine, it just doesn't get better. burn fat, tone your physique, reduce your appetite, and increase your energy levels now.whether it's using hydrashred to burn body fat or even use it as a pre-workout powdered thermogenic, it has a place in everyone's supplement routine. since hydrashred conveniently comes in a ready-to-mix delicious powder, you can mix it in ice-cold water and sip on it all day.https://redsupps.co.uk/products/hydrashred-lypolitic-fat-burnerhttps://cdn.shopify.com/s/files/1/2544/1734/products/coldbrewcoffee_2048x2048_64d03f03-06e3-4a7e-88d6-f37b8cae1cbc_600x600_crop_center.jpg?v=1540373179SPARTA NUTRITION new 733883760691in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsFat Burner 29.00GBP shopify_520100380723_6993212538931Hype benefitsskin ripping pumpsincreased bloodflow descriptionmen and women alike train for countless hours each week all in pursuit of the ultimate pump. nothing is more elusive, or rewarding, than having a massive pump while you train. unfortunately, within 30 minutes of leaving the gym, your pump is gone, and you’re back to looking like you’re average, scrawny self. wouldn’t it be great to have a pump that lasted for hours after you finished lifting? blackstone labs has developed the ultimate supplement to keep your muscles swollen all day long in hype.hype is a 100% stimulant free nitric oxide boosting supplement providing maximum muscle pumps all day, every day. it’s ideal to stack with any stim-based pre workout or used as a standalone option for those sensitive to caffeine or training at night. stop getting frustrated with a short-lived pump, and start looking, and feeling, better with hype. instructionsas a dietary supplement, take one (1) scoop with 6-8 oz. of water once per day, 20 minutes before a workout. do not exceed two (2) scoops daily.https://redsupps.co.uk/products/hypehttps://cdn.shopify.com/s/files/1/2544/1734/products/hype-orange_600x600_crop_center.png?v=1540373187Blackstone Labs new 520100380723in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 29.99GBP shopify_520100380723_6993213325363Hype benefitsskin ripping pumpsincreased bloodflow descriptionmen and women alike train for countless hours each week all in pursuit of the ultimate pump. nothing is more elusive, or rewarding, than having a massive pump while you train. unfortunately, within 30 minutes of leaving the gym, your pump is gone, and you’re back to looking like you’re average, scrawny self. wouldn’t it be great to have a pump that lasted for hours after you finished lifting? blackstone labs has developed the ultimate supplement to keep your muscles swollen all day long in hype.hype is a 100% stimulant free nitric oxide boosting supplement providing maximum muscle pumps all day, every day. it’s ideal to stack with any stim-based pre workout or used as a standalone option for those sensitive to caffeine or training at night. stop getting frustrated with a short-lived pump, and start looking, and feeling, better with hype. instructionsas a dietary supplement, take one (1) scoop with 6-8 oz. of water once per day, 20 minutes before a workout. do not exceed two (2) scoops daily.https://redsupps.co.uk/products/hypehttps://cdn.shopify.com/s/files/1/2544/1734/products/hype-orange_600x600_crop_center.png?v=1540373187Blackstone Labs new 520100380723in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 29.99GBP shopify_369634705445_4714161864741Hype extreme  hype extremedramatically increases n.o. production and vascularitystimulant free descriptionthe pump is the stuff of legend. ever since arnold discussed the phenomenon in pumping iron, the pump has been the driving force behind many a workout. lifters train relentlessly all in the hopes of capturing the ultimate muscle pump, the kind where your sleeves are busting and veins are bursting through your skin. the pump is an elusive beast, one the eludes even the most hardcore lifters out there...but not anymore.hype extreme from blackstone labs is the ultimate muscle-swelling, vein-gorging, and sleeve-busting pre workout on the market. hype extreme is stimulant free and provides a robust combination of nitric oxide boosting ingredients to generate a raging pump that lasts all day long. blackstone labs has also included a hefty dose of nootropics to combat mental fatigue and enhance focus in the midst of your battle against the iron.pumps, focus, endurance -- hype extreme delivers it all! ingredientshydromax (2g) is the premier form of glycerol supplement on the market that drives extra water and nutrients into your muscle cells. hydromax aids hydration, stamina, endurance, and also yields some pretty epic water-based pumps too!sodium nitrate (1.5g) creates a powerful surge in nitric oxide production. nitrates are 100% bioavailable and can increase plasma no levels by 138%, delivering significant vascularity and blood flow to working muscles leading to a massive muscle pump.rhodiola rosea (300mg) eases mental and physical fatigue during intense exercise, leading to greater performance. as an adaptogen, rhodiola also combats stress, keeping you calm, cool, and collected in the face of adversity.alpha gpc (250mg) fosters a strong mind-muscle connection by increasing levels of the neurotransmitter acetylcholine, a.k.a. “the learning neurotransmitter.” with alpha gpc, you’ll feel every muscle fiber becoming engorged as you grind out rep after rep.huperzine a (300mcg) supports acetylcholine production in the body by inhibiting acetylcholinesterase, the enzyme that degrades acetylcholine. the 1-2 punch of huperzine and alpha gpc promote incredibly strong, long-lasting focus that delivers tunnel vision like you’ve never experienced before. instructionsas a dietary supplement, take one (1) scoop mixed with 8 oz. of water, 30 minutes before a workout. do not exceed one (1) scoop in a 24 hour period.https://redsupps.co.uk/products/blackstone-labs-hype-extremehttps://cdn.shopify.com/s/files/1/2544/1734/products/hypeextreme-cottoncandy_600x600_crop_center.png?v=1540373197Blackstone Labs new 369634705445in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 34.00GBP shopify_369634705445_4714161897509Hype extreme  hype extremedramatically increases n.o. production and vascularitystimulant free descriptionthe pump is the stuff of legend. ever since arnold discussed the phenomenon in pumping iron, the pump has been the driving force behind many a workout. lifters train relentlessly all in the hopes of capturing the ultimate muscle pump, the kind where your sleeves are busting and veins are bursting through your skin. the pump is an elusive beast, one the eludes even the most hardcore lifters out there...but not anymore.hype extreme from blackstone labs is the ultimate muscle-swelling, vein-gorging, and sleeve-busting pre workout on the market. hype extreme is stimulant free and provides a robust combination of nitric oxide boosting ingredients to generate a raging pump that lasts all day long. blackstone labs has also included a hefty dose of nootropics to combat mental fatigue and enhance focus in the midst of your battle against the iron.pumps, focus, endurance -- hype extreme delivers it all! ingredientshydromax (2g) is the premier form of glycerol supplement on the market that drives extra water and nutrients into your muscle cells. hydromax aids hydration, stamina, endurance, and also yields some pretty epic water-based pumps too!sodium nitrate (1.5g) creates a powerful surge in nitric oxide production. nitrates are 100% bioavailable and can increase plasma no levels by 138%, delivering significant vascularity and blood flow to working muscles leading to a massive muscle pump.rhodiola rosea (300mg) eases mental and physical fatigue during intense exercise, leading to greater performance. as an adaptogen, rhodiola also combats stress, keeping you calm, cool, and collected in the face of adversity.alpha gpc (250mg) fosters a strong mind-muscle connection by increasing levels of the neurotransmitter acetylcholine, a.k.a. “the learning neurotransmitter.” with alpha gpc, you’ll feel every muscle fiber becoming engorged as you grind out rep after rep.huperzine a (300mcg) supports acetylcholine production in the body by inhibiting acetylcholinesterase, the enzyme that degrades acetylcholine. the 1-2 punch of huperzine and alpha gpc promote incredibly strong, long-lasting focus that delivers tunnel vision like you’ve never experienced before. instructionsas a dietary supplement, take one (1) scoop mixed with 8 oz. of water, 30 minutes before a workout. do not exceed one (1) scoop in a 24 hour period.https://redsupps.co.uk/products/blackstone-labs-hype-extremehttps://cdn.shopify.com/s/files/1/2544/1734/products/hypeextreme-cottoncandy_600x600_crop_center.png?v=1540373197Blackstone Labs new 369634705445in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 34.00GBP shopify_1624829952051_15851210702899Hype extreme sample Key featuresdramatically increases n.o. production and vascularitystimulant free descriptionthe pump is the stuff of legend. ever since arnold discussed the phenomenon in pumping iron, the pump has been the driving force behind many a workout. lifters train relentlessly all in the hopes of capturing the ultimate muscle pump, the kind where your sleeves are busting and veins are bursting through your skin. the pump is an elusive beast, one the eludes even the most hardcore lifters out there...but not anymore.hype extreme from blackstone labs is the ultimate muscle-swelling, vein-gorging, and sleeve-busting pre-workout on the market. hype extreme is stimulant free and provides a robust combination of nitric oxide boosting ingredients to generate a raging pump that lasts all day long. blackstone labs has also included a hefty dose of nootropics to combat mental fatigue and enhance focus in the midst of your battle against the iron.pumps, focus, endurance -- hype extreme delivers it all! https://redsupps.co.uk/products/hype-extreme-samplehttps://cdn.shopify.com/s/files/1/2544/1734/products/hypeextreme-fruitpunch-sample_1024x_da3eab48-11c3-4166-adca-a6ea276da45f_600x600_crop_center.png?v=1544105295Blackstone Labs new 1624829952051in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 0.00GBP shopify_1624829952051_15851210735667Hype extreme sample Key featuresdramatically increases n.o. production and vascularitystimulant free descriptionthe pump is the stuff of legend. ever since arnold discussed the phenomenon in pumping iron, the pump has been the driving force behind many a workout. lifters train relentlessly all in the hopes of capturing the ultimate muscle pump, the kind where your sleeves are busting and veins are bursting through your skin. the pump is an elusive beast, one the eludes even the most hardcore lifters out there...but not anymore.hype extreme from blackstone labs is the ultimate muscle-swelling, vein-gorging, and sleeve-busting pre-workout on the market. hype extreme is stimulant free and provides a robust combination of nitric oxide boosting ingredients to generate a raging pump that lasts all day long. blackstone labs has also included a hefty dose of nootropics to combat mental fatigue and enhance focus in the midst of your battle against the iron.pumps, focus, endurance -- hype extreme delivers it all! https://redsupps.co.uk/products/hype-extreme-samplehttps://cdn.shopify.com/s/files/1/2544/1734/products/hypeextreme-fruitpunch-sample_1024x_da3eab48-11c3-4166-adca-a6ea276da45f_600x600_crop_center.png?v=1544105295Blackstone Labs new 1624829952051in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 0.00GBP shopify_1624829952051_15879383744563Hype extreme sample Key featuresdramatically increases n.o. production and vascularitystimulant free descriptionthe pump is the stuff of legend. ever since arnold discussed the phenomenon in pumping iron, the pump has been the driving force behind many a workout. lifters train relentlessly all in the hopes of capturing the ultimate muscle pump, the kind where your sleeves are busting and veins are bursting through your skin. the pump is an elusive beast, one the eludes even the most hardcore lifters out there...but not anymore.hype extreme from blackstone labs is the ultimate muscle-swelling, vein-gorging, and sleeve-busting pre-workout on the market. hype extreme is stimulant free and provides a robust combination of nitric oxide boosting ingredients to generate a raging pump that lasts all day long. blackstone labs has also included a hefty dose of nootropics to combat mental fatigue and enhance focus in the midst of your battle against the iron.pumps, focus, endurance -- hype extreme delivers it all! https://redsupps.co.uk/products/hype-extreme-samplehttps://cdn.shopify.com/s/files/1/2544/1734/products/hypeextreme-fruitpunch-sample_1024x_da3eab48-11c3-4166-adca-a6ea276da45f_600x600_crop_center.png?v=1544105295Blackstone Labs new 1624829952051in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 0.00GBP shopify_1624829952051_15879383777331Hype extreme sample Key featuresdramatically increases n.o. production and vascularitystimulant free descriptionthe pump is the stuff of legend. ever since arnold discussed the phenomenon in pumping iron, the pump has been the driving force behind many a workout. lifters train relentlessly all in the hopes of capturing the ultimate muscle pump, the kind where your sleeves are busting and veins are bursting through your skin. the pump is an elusive beast, one the eludes even the most hardcore lifters out there...but not anymore.hype extreme from blackstone labs is the ultimate muscle-swelling, vein-gorging, and sleeve-busting pre-workout on the market. hype extreme is stimulant free and provides a robust combination of nitric oxide boosting ingredients to generate a raging pump that lasts all day long. blackstone labs has also included a hefty dose of nootropics to combat mental fatigue and enhance focus in the midst of your battle against the iron.pumps, focus, endurance -- hype extreme delivers it all! https://redsupps.co.uk/products/hype-extreme-samplehttps://cdn.shopify.com/s/files/1/2544/1734/products/hypeextreme-fruitpunch-sample_1024x_da3eab48-11c3-4166-adca-a6ea276da45f_600x600_crop_center.png?v=1544105295Blackstone Labs new 1624829952051in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 0.00GBP shopify_1624837849139_15851227578419Hype sample Key featuresskin ripping pumpsincreased blood flow descriptionmen and women alike train for countless hours each week all in pursuit of the ultimate pump. nothing is more elusive, or rewarding, than having a massive pump while you train. unfortunately, within 30 minutes of leaving the gym, your pump is gone, and you’re back to looking like you’re average, scrawny self. wouldn’t it be great to have a pump that lasted for hours after you finished lifting? blackstone labs has developed the ultimate supplement to keep your muscles swollen all day long in hype.hype is a 100% stimulant free nitric oxide boosting supplement providing maximum muscle pumps all day, every day. it’s ideal to stack with any stim-based pre-workout or used as a standalone option for those sensitive to caffeine or training at night. stop getting frustrated with a short-lived pump, and start looking, and feeling, better with hype.https://redsupps.co.uk/products/hype-samplehttps://cdn.shopify.com/s/files/1/2544/1734/products/hype-sample-fruitpunch_1024x_2d1574ce-7c16-4e10-9239-83f1142e565c_600x600_crop_center.png?v=1544105643Blackstone Labs new 1624837849139in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 0.00GBP shopify_1624837849139_15851227611187Hype sample Key featuresskin ripping pumpsincreased blood flow descriptionmen and women alike train for countless hours each week all in pursuit of the ultimate pump. nothing is more elusive, or rewarding, than having a massive pump while you train. unfortunately, within 30 minutes of leaving the gym, your pump is gone, and you’re back to looking like you’re average, scrawny self. wouldn’t it be great to have a pump that lasted for hours after you finished lifting? blackstone labs has developed the ultimate supplement to keep your muscles swollen all day long in hype.hype is a 100% stimulant free nitric oxide boosting supplement providing maximum muscle pumps all day, every day. it’s ideal to stack with any stim-based pre-workout or used as a standalone option for those sensitive to caffeine or training at night. stop getting frustrated with a short-lived pump, and start looking, and feeling, better with hype.https://redsupps.co.uk/products/hype-samplehttps://cdn.shopify.com/s/files/1/2544/1734/products/hype-sample-fruitpunch_1024x_2d1574ce-7c16-4e10-9239-83f1142e565c_600x600_crop_center.png?v=1544105643Blackstone Labs new 1624837849139in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 0.00GBP shopify_1624837849139_15879383679027Hype sample Key featuresskin ripping pumpsincreased blood flow descriptionmen and women alike train for countless hours each week all in pursuit of the ultimate pump. nothing is more elusive, or rewarding, than having a massive pump while you train. unfortunately, within 30 minutes of leaving the gym, your pump is gone, and you’re back to looking like you’re average, scrawny self. wouldn’t it be great to have a pump that lasted for hours after you finished lifting? blackstone labs has developed the ultimate supplement to keep your muscles swollen all day long in hype.hype is a 100% stimulant free nitric oxide boosting supplement providing maximum muscle pumps all day, every day. it’s ideal to stack with any stim-based pre-workout or used as a standalone option for those sensitive to caffeine or training at night. stop getting frustrated with a short-lived pump, and start looking, and feeling, better with hype.https://redsupps.co.uk/products/hype-samplehttps://cdn.shopify.com/s/files/1/2544/1734/products/hype-sample-fruitpunch_1024x_2d1574ce-7c16-4e10-9239-83f1142e565c_600x600_crop_center.png?v=1544105643Blackstone Labs new 1624837849139in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 0.00GBP shopify_1624837849139_15879383711795Hype sample Key featuresskin ripping pumpsincreased blood flow descriptionmen and women alike train for countless hours each week all in pursuit of the ultimate pump. nothing is more elusive, or rewarding, than having a massive pump while you train. unfortunately, within 30 minutes of leaving the gym, your pump is gone, and you’re back to looking like you’re average, scrawny self. wouldn’t it be great to have a pump that lasted for hours after you finished lifting? blackstone labs has developed the ultimate supplement to keep your muscles swollen all day long in hype.hype is a 100% stimulant free nitric oxide boosting supplement providing maximum muscle pumps all day, every day. it’s ideal to stack with any stim-based pre-workout or used as a standalone option for those sensitive to caffeine or training at night. stop getting frustrated with a short-lived pump, and start looking, and feeling, better with hype.https://redsupps.co.uk/products/hype-samplehttps://cdn.shopify.com/s/files/1/2544/1734/products/hype-sample-fruitpunch_1024x_2d1574ce-7c16-4e10-9239-83f1142e565c_600x600_crop_center.png?v=1544105643Blackstone Labs new 1624837849139in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 0.00GBP