Red Supps Products The ultimate product feed for Facebook - part of the Pixel Perfect app by wyred-up https://redsupps.co.uk shopify_369642438693_4714185785381"make bodybuilding great again" Emblazoned with a red, white, and blue variant of the blackstone labs logo. "make bodybuilding great again" is printed on the back.https://redsupps.co.uk/products/blackstone-labs-make-bodybuilding-great-againhttps://cdn.shopify.com/s/files/1/2544/1734/products/makebodybuildinggreatagain-01-600x857_1024x_2290dd12-cb16-4f69-b290-b5bea5d60c59_600x600_crop_center.jpg?v=1539138744Blackstone Labs new 369642438693in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_369642438693_4714185818149"make bodybuilding great again" Emblazoned with a red, white, and blue variant of the blackstone labs logo. "make bodybuilding great again" is printed on the back.https://redsupps.co.uk/products/blackstone-labs-make-bodybuilding-great-againhttps://cdn.shopify.com/s/files/1/2544/1734/products/makebodybuildinggreatagain-01-600x857_1024x_2290dd12-cb16-4f69-b290-b5bea5d60c59_600x600_crop_center.jpg?v=1539138744Blackstone Labs new 369642438693in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_8084826259507"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1539138746Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_8084826292275"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1539138746Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_8084826325043"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1539138746Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_8084826357811"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1539138746Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_8084826390579"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1539138746Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_13021730373683"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1539138746Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_13021730406451"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1539138746Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_13021730439219"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1539138746Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_13021730471987"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1539138746Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_666193231923_13021730504755"parental advisory" Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. warning: the gains of this individual are unsuitable for minorshttps://redsupps.co.uk/products/parental-advisoryhttps://cdn.shopify.com/s/files/1/2544/1734/products/parental-advisory_1024x_9f689b12-cd5b-483e-b7da-471823613935_600x600_crop_center.jpg?v=1539138746Blackstone Labs new 666193231923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 15.99GBP shopify_699340587059_8438659711027"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1539138750Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 14.99GBP shopify_699340587059_8438659743795"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1539138750Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 14.99GBP shopify_699340587059_8438659776563"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1539138750Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 14.99GBP shopify_699340587059_8438659809331"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1539138750Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 14.99GBP shopify_699340587059_8438659842099"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1539138750Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 14.99GBP shopify_699340587059_13007301738547"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1539138750Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 14.99GBP shopify_699340587059_13007301771315"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1539138750Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 14.99GBP shopify_699340587059_13007301804083"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1539138750Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 14.99GBP shopify_699340587059_13007301836851"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1539138750Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 14.99GBP shopify_699340587059_13007301869619"sup girl," Too busy with your nose to the grind to initiate conversation? let our 'sup girl' shirt do the talking for you. difficult conversations are made simple when your greeting is on display. we highly suggest having your blackstone labs pre-workout with you to follow up with “have you tried how great dust v2 is?” not just for men, this tri-blend shirt is perfect for everybody.https://redsupps.co.uk/products/sup-girlhttps://cdn.shopify.com/s/files/1/2544/1734/products/sup-girl_1024x_213d886b-061c-40ab-804f-42c90aa2e563_600x600_crop_center.jpg?v=1539138750Blackstone Labs new 699340587059in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 14.99GBP shopify_474919960613_5242680344613''loyality is everything'' 100% preshrunk cotton with a classic fit.whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym. let them know that staying true is everything with this #beauthentic tee today.https://redsupps.co.uk/products/loyality-is-everythinghttps://cdn.shopify.com/s/files/1/2544/1734/products/loyalty-is-everything_1024x_151b1402-e290-4889-bdfd-4face192faf3_600x600_crop_center.jpg?v=1539138759Blackstone Labs new 474919960613in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 14.99GBP shopify_474919960613_5242680377381''loyality is everything'' 100% preshrunk cotton with a classic fit.whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym. let them know that staying true is everything with this #beauthentic tee today.https://redsupps.co.uk/products/loyality-is-everythinghttps://cdn.shopify.com/s/files/1/2544/1734/products/loyalty-is-everything_1024x_151b1402-e290-4889-bdfd-4face192faf3_600x600_crop_center.jpg?v=1539138759Blackstone Labs new 474919960613in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 14.99GBP shopify_474919960613_5242680410149''loyality is everything'' 100% preshrunk cotton with a classic fit.whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym. let them know that staying true is everything with this #beauthentic tee today.https://redsupps.co.uk/products/loyality-is-everythinghttps://cdn.shopify.com/s/files/1/2544/1734/products/loyalty-is-everything_1024x_151b1402-e290-4889-bdfd-4face192faf3_600x600_crop_center.jpg?v=1539138759Blackstone Labs new 474919960613in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 14.99GBP shopify_474919960613_5242680442917''loyality is everything'' 100% preshrunk cotton with a classic fit.whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym. let them know that staying true is everything with this #beauthentic tee today.https://redsupps.co.uk/products/loyality-is-everythinghttps://cdn.shopify.com/s/files/1/2544/1734/products/loyalty-is-everything_1024x_151b1402-e290-4889-bdfd-4face192faf3_600x600_crop_center.jpg?v=1539138759Blackstone Labs new 474919960613in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 14.99GBP shopify_474919960613_5242680475685''loyality is everything'' 100% preshrunk cotton with a classic fit.whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym. let them know that staying true is everything with this #beauthentic tee today.https://redsupps.co.uk/products/loyality-is-everythinghttps://cdn.shopify.com/s/files/1/2544/1734/products/loyalty-is-everything_1024x_151b1402-e290-4889-bdfd-4face192faf3_600x600_crop_center.jpg?v=1539138759Blackstone Labs new 474919960613in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsT-Shirt 14.99GBP shopify_473656557605_52375794483573-whey 2lbs 3-whey protein blend3 types of blended proteinhelps build muscle and strength descriptionrefuel your muscles with 3-whey, a protein unlike any you’ve tried before. 3-whey contains a trio of ultra-effective, highly bioavailable whey proteins your muscles need to repair, rebuild, and grow following intense training. ingredientsprotein blend 3-whey uses a precisely formulated threesome of proteins in whey protein hydrolysate, whey protein isolate, and whey protein concentrate to infuse your muscles with a monster load of muscle-building amino acids, stimulating protein synthesis, muscle growth, and recovery. instructionsas a dietary supplement, mix one (1) scoop of 3-whey with 6-8 oz. of water.https://redsupps.co.uk/products/3-wheyhttps://cdn.shopify.com/s/files/1/2544/1734/products/3whey-chocolate_fb845b03-af50-4661-83ed-af8e1073e772_600x600_crop_center.png?v=1539610080Blackstone Labs new 473656557605in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Blend 29.00GBP shopify_473656557605_80283945206273-whey 2lbs 3-whey protein blend3 types of blended proteinhelps build muscle and strength descriptionrefuel your muscles with 3-whey, a protein unlike any you’ve tried before. 3-whey contains a trio of ultra-effective, highly bioavailable whey proteins your muscles need to repair, rebuild, and grow following intense training. ingredientsprotein blend 3-whey uses a precisely formulated threesome of proteins in whey protein hydrolysate, whey protein isolate, and whey protein concentrate to infuse your muscles with a monster load of muscle-building amino acids, stimulating protein synthesis, muscle growth, and recovery. instructionsas a dietary supplement, mix one (1) scoop of 3-whey with 6-8 oz. of water.https://redsupps.co.uk/products/3-wheyhttps://cdn.shopify.com/s/files/1/2544/1734/products/3whey-chocolate_fb845b03-af50-4661-83ed-af8e1073e772_600x600_crop_center.png?v=1539610080Blackstone Labs new 473656557605in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Blend 29.00GBP shopify_473656557605_52375793828213-whey 2lbs 3-whey protein blend3 types of blended proteinhelps build muscle and strength descriptionrefuel your muscles with 3-whey, a protein unlike any you’ve tried before. 3-whey contains a trio of ultra-effective, highly bioavailable whey proteins your muscles need to repair, rebuild, and grow following intense training. ingredientsprotein blend 3-whey uses a precisely formulated threesome of proteins in whey protein hydrolysate, whey protein isolate, and whey protein concentrate to infuse your muscles with a monster load of muscle-building amino acids, stimulating protein synthesis, muscle growth, and recovery. instructionsas a dietary supplement, mix one (1) scoop of 3-whey with 6-8 oz. of water.https://redsupps.co.uk/products/3-wheyhttps://cdn.shopify.com/s/files/1/2544/1734/products/3whey-chocolate_fb845b03-af50-4661-83ed-af8e1073e772_600x600_crop_center.png?v=1539610080Blackstone Labs new 473656557605in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Blend 29.00GBP shopify_473656557605_80283987804673-whey 2lbs 3-whey protein blend3 types of blended proteinhelps build muscle and strength descriptionrefuel your muscles with 3-whey, a protein unlike any you’ve tried before. 3-whey contains a trio of ultra-effective, highly bioavailable whey proteins your muscles need to repair, rebuild, and grow following intense training. ingredientsprotein blend 3-whey uses a precisely formulated threesome of proteins in whey protein hydrolysate, whey protein isolate, and whey protein concentrate to infuse your muscles with a monster load of muscle-building amino acids, stimulating protein synthesis, muscle growth, and recovery. instructionsas a dietary supplement, mix one (1) scoop of 3-whey with 6-8 oz. of water.https://redsupps.co.uk/products/3-wheyhttps://cdn.shopify.com/s/files/1/2544/1734/products/3whey-chocolate_fb845b03-af50-4661-83ed-af8e1073e772_600x600_crop_center.png?v=1539610080Blackstone Labs new 473656557605in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Blend 29.00GBP shopify_473656557605_84569291817473-whey 2lbs 3-whey protein blend3 types of blended proteinhelps build muscle and strength descriptionrefuel your muscles with 3-whey, a protein unlike any you’ve tried before. 3-whey contains a trio of ultra-effective, highly bioavailable whey proteins your muscles need to repair, rebuild, and grow following intense training. ingredientsprotein blend 3-whey uses a precisely formulated threesome of proteins in whey protein hydrolysate, whey protein isolate, and whey protein concentrate to infuse your muscles with a monster load of muscle-building amino acids, stimulating protein synthesis, muscle growth, and recovery. instructionsas a dietary supplement, mix one (1) scoop of 3-whey with 6-8 oz. of water.https://redsupps.co.uk/products/3-wheyhttps://cdn.shopify.com/s/files/1/2544/1734/products/3whey-chocolate_fb845b03-af50-4661-83ed-af8e1073e772_600x600_crop_center.png?v=1539610080Blackstone Labs new 473656557605in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Blend 29.00GBP shopify_473656557605_129287646740993-whey 2lbs 3-whey protein blend3 types of blended proteinhelps build muscle and strength descriptionrefuel your muscles with 3-whey, a protein unlike any you’ve tried before. 3-whey contains a trio of ultra-effective, highly bioavailable whey proteins your muscles need to repair, rebuild, and grow following intense training. ingredientsprotein blend 3-whey uses a precisely formulated threesome of proteins in whey protein hydrolysate, whey protein isolate, and whey protein concentrate to infuse your muscles with a monster load of muscle-building amino acids, stimulating protein synthesis, muscle growth, and recovery. instructionsas a dietary supplement, mix one (1) scoop of 3-whey with 6-8 oz. of water.https://redsupps.co.uk/products/3-wheyhttps://cdn.shopify.com/s/files/1/2544/1734/products/3whey-chocolate_fb845b03-af50-4661-83ed-af8e1073e772_600x600_crop_center.png?v=1539610080Blackstone Labs new 473656557605in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Blend 29.00GBP shopify_369643651109_4714190503973Abnormal  abnormalpro anobolic precursortime-released delivery system descriptionyou know blackstone labs is anything but normal. we push the extremes in everything we do, and it’s only fitting that we’ve created the ultimate abnormal muscle builder. abnormal is an incredibly powerful 19-nordhea supplement offering superior bioavailability for maximum muscle growth and increased testosterone production.  directionsas a dietary supplement, take one (1) tablet two (2) times per day. do not exceed two (2) tablets daily.https://redsupps.co.uk/products/blackstone-labs-abnormal-60tab-abnormal-by-choice-massive-gainshttps://cdn.shopify.com/s/files/1/2544/1734/products/abNORmal_ffabe8ec-0ce9-4e8c-913f-ef95eb57476d_600x600_crop_center.png?v=1539138788Blackstone Labs new 369643651109in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Builder 49.99GBP shopify_719609200691_8548135010355Adam descriptionwith saw palmetto, plant sterols, lycopene, nettle root & coq10gentler and easier to swallow & absorba dietary supplementvitaminsfamily owned since 1968quality gmp assuredthese multi-vitamin softgels are easier to swallow, and are formulated for better gi tolerability. suggested usetake 2 softgels daily with food. other ingredientssoftgel capsule (bovine gelatin, glycerin, water, carob), pumpkin seed oil, sunflower lecithin, beeswax, and cinnamon (cinnamomum cassia) (bark) oil.contains soy. https://redsupps.co.uk/products/adam-180-softgels-1https://cdn.shopify.com/s/files/1/2544/1734/products/adam_600x600_crop_center.jpg?v=1539138792NOW FOODS new 719609200691in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMultivitamin 35.99GBP shopify_706178842675_8461480820787Adrenal care benefitssupports healthy and optimal adrenal gland functionsupports healthy cortisol levels descriptionadrenal fatigue is a collection of symptoms that can occur when your level of stress – whether it is physical, emotional, mental, or a combination – overwhelms your body's ability to compensate for that stress. adrenal care is designed to give your body what it needs to fight back against the physical symptoms of stress and help normalize your tolerance to stress-inducing stimulants.stress hits us all, some more than others. stress can essentially strip all of the nutrients away from where it's needed, like building important regulatory hormones. our adrenal hormones are needed in order to regulate our complicated day to day processes, staying focused, and sleep properly. blackstone labs set out to support these adrenal hormones with its proprietary, cutting-edge formula, adrenal care. blackstone labs specifically designed adrenal care to promote sound hpa axis gland structure and adrenal fatigue recovery.it contains important compounds that are required in adrenal hormone synthesis and energy production†it's formulated with optimal bioavailability of its active constituents †adrenal care has unique nutrient amounts for effective support during stress and adrenal fatigue†it's synergistic combination enhances efficacy of individual nutrients†its unique protein-based building blocks for sound hpa axis gland structure are able to sustain healthy functions†supports brain health and cognitive health†adrenal care by blackstone labs is the foremost adrenal support product available today. adrenal care supports the building of these regulating hormones with the raw materials it needs and gives you that extra balance you need to stay feeling great. adrenal glandulars are adrenal supplements made up of actual adrenal gland tissue. adrenal care provides the support your adrenals need to repair themselves and return to normal function. adrenal care should be your first choice of adrenal support supplements for mild to moderate cases of adrenal fatigue. ingredientszinc (30mg)one of the 24 micronutrients needed for survival, zinc benefits everything from testosterone to immune function.inositol hexanicotinate (750mg)inositol hexanicotinate (inh), often marketed as "no flush" niacin, allows you to derive the substantial metabolic benefits of niacin (vit. b3) without the uncomfortable flushing sensation that often accompanies supplemental niacin.dmae (750mg)dmae (dimethylaminoethanol) can readily cross the blood brain barrier where it then acts as both a protective compound and helps the body synthesize its primary neurotransmitter, acetylcholine. dmae supplementation has shown a variety of therapeutic benefits for cognitive disorders like attention-deficit hyperactivity disorder and memory lapses.bovine adrenal gland extract (500mg)glandular extracts come from the hormone-producing glands of animals and are beneficial for individuals not getting adequate daily nutrients—particularly those that support the adrenal and thyroid glands. glandular extracts often have a tonic effect on the body by correcting deficiencies of limiting adrenal nutrients required for the synthesis of protective or energetic hormones.magnesium glycinate (300mg)magnesium is the second most prevalent electrolyte in the human body, an essential dietary mineral, and (perhaps most importantly) the most commonly deficient mineral in the standard american diet. in the context of the adrenals, magnesium helps the body, from its muscles down to its literal cells, relax. relaxed cells are able to then achieve a high-energy state associated with rest and repair. overstimulated cells are calcium dominant, and the magnesium displaces the calcium. in states of adrenal fatigue, cells are chronically overstimulated and thus exhausted. magnesium counteracts this overexcited state. this particular form of magnesium, glycinate, is readily absorbed from the intestine and less likely to produce gastrointestinal side-effects like diarrhea and bloating.glycyrrhetinic acid (licorice extract) (200mg)glycyrrhetinic acid inhibits both 11β-hydroxysteroid dehydrogenase enzymes (type 1 and type 2, the enzymes that control cortisol levels), with slightly more effect on the type i (anti-cortisol) than type ii (pro-cortisol). therefore, the net effect is a reduction in serum cortisol (a stress hormone that is chronically elevated in those with adrenal fatigue). the decrease in cortisol increase has been noted to be 39-50% after 3-500mg glycyrrhetinic acid (the active ingredient in adrenal care)—which is substantial. in other words, the glycyrrhetinic acid in adrenal care can potentially cut your stress levels (as measured by cortisol) in half.korean ginseng (1% eleutherosides) (100mg)an herb used in traditional chinese medicine (tcm) for thousands of years, eleutherococcus reduces lethargy and fatigue, improves stamina and endurance, and boosts resilience to environmental stressors.huperzine a (huperzia serrata) (moss) (300mcg)huperzine a's most recognized and desired action is inhibiting the acetylcholinesterase enzyme. this effect, coupled with co-ingestion of a choline donor like the dmae in adrenal care, prolongs and magnifies the benefits. in addition to positive effects on mood and muscle contraction, huperzine a can even improve learning. instructionsas a dietary supplement, take two (2) twice daily. do not exceed four (4) tablets daily. finish entire contents of bottle over a thirty (30) day period.https://redsupps.co.uk/products/adrenal-care-120tabhttps://cdn.shopify.com/s/files/1/2544/1734/products/adrenalcare_600x600_crop_center.png?v=1539138795Blackstone Labs new 706178842675in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAdrenal support 34.99GBP shopify_711027916851_8489343221811Altrient alc liposomal acetyl l-carnitine  descriptionif you want to raise your energy levels, maintain mental clarity, look after your heart and decrease your risk of type diabetes - look no further. carnitine could help to put the brakes on the ageing process.it plays a crucial role in the production of energy in the mitochondria - the powerhouses of the cells, where it transports long-chain fatty acids to be burned or ‘oxidised ’ to produce energy.not only does carnitine increase the mitochondria’s potential to burn fat, acetyl l-carnitine (alc) is also known for its ability to optimize brain function because it can cross into the brain more effectively than regular carnitine.while in the brain, alc helps protect nerve cells from losing receptors that allow neurons in the brain to communicate effectively with one another. it supports the natural production of acetylcholine, an important neurotransmitter.plays a critical role in turning fat into energyhelps maintain normal cognitive functioning of the brainacts as an antioxidant, helping to reduce oxidative stress and inflammationcontributes to the normal functioning of muscle metabolism and performancehelps to protect cardiovascular health  altrient alc nutritional factsserving size: 1 sachet (5.7ml) servings per container: 30amount per serving % rda*acetyl l-carnitine1000 mg†phospholipids1000 mg†of which phosphatidylcholine500 mg†* recommended daily allowance †rda not establishedingredients: deionized water, acetyl l-carnitine, lecithin phospholipids, alcohol, potassium hydroxide chloride (ph adjustment), xanthum gum.contains no sugar, no starch, no artificial flavours, no artificial colours, no meat products, no dairy products, no wheat, no gluten and no yeast.  dosage as a dietary supplement take 1-2 sachets per day.higher therapeutic doses may be necessary, take advice from your doctor or health practitioner.if you are pregnant or breastfeeding, consult a healthcare practitioner before using this product.for best results, snip or tear the notched end off the sachet, squeeze the gel contents into a small amount of water or your favourite cool beverage and shot it down quickly.to speed up absorption drink on an empty stomach, and wait at least 15 minutes before eating. storage store in a cool, dry place, can be refrigerated.do not freeze or place the product in direct sunlight for extended periods of time. https://redsupps.co.uk/products/altrient-alc-liposomal-acetyl-l-carnitinehttps://cdn.shopify.com/s/files/1/2544/1734/products/altrient-alc-liposomal-acetyl-l-carnitine-livon-labs_600x600_crop_center.jpg?v=1539138799Livon new 711027916851in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIPOSOMAL ACETYL L-CARNITINE 59.99GBP shopify_710941540403_8489053159475Altrient b liposomal vitamin b  descriptionmost ordinary forms of b complex vitamins – tablets, capsules, powders, liquids and even dietary sources are not retained fully by the body. it can only store limited amounts of b vitamins because they are all water-soluble, and therefore any excess is excreted in the urine. finding a supplement that provides highly bioavailable b vitamins is crucial for the body to maintain its energy levels.choosing altrient b is the perfect solution. this unique liposomal vitamin complex is capable of delivering a much higher absorption rate than other products on the market. altrient b uses ingenious let technology to encapsulate the nutrients inside tiny phospholipid bubbles that by-pass the digestive system, transporting the contents directly to the cells that need them - allowing for almost 100% bioavailability.vital for maintaining energy and metabolic function.contributes to healthy hair, nails and skin.supports optimum memory and brain function.contributes to healthy cell renewal and function of the nervous system.enhances glucose metabolism and helps regulate insulin sensitivity.nature cleverly combines nutrients in food that work together very effectively to provide a multitude of health benefits. as an example, broccoli provides vitamin c, alpha lipoic acid, b vitamins and a whole range of other beneficial compounds. these combined nutrients have a far greater effect on health than an individual nutrient working alone.combining supplements in a similar way ensures that the co-factors needed to stimulate activity of specific nutrients such as vitamin c are available to maximise its effects in the body. with this in mind, we have carefully paired nutrients that have a powerful synergy so we can offer you the perfect combinations for sparkling good health. nutritional facts altrient b nutritional facts: 1 sachet (6ml) 30 sachet's per box amount per serving% nrv   vitamin b1 (as thiamine hcl)100 mg9,091%vitamin b2 (as riboflavin)8.5 mg607%niacin (as niacinamide)20 mg125%pantothenic acid (as d-calcium pantothenate)10 mg167%vitamin b6 (as pyridoxine hci)10 mg714%folate ([6s]-5-methyltetrahydrofolic acid, as 200μg quatrefolic® [6s]-5-methyltetrahydrofolic acid,glucosamine salt)100 μg50%vitamin b12(as methylcobalamin and cyanocobalamin)50 μg2,000%biotin (as d-biotin)300 μg600%mineralszinc (as zinc glycinate)20 mg200%selenium (as selenomethionine)50 μg91%chromium (as chromium picolinate)50 μg125%other ingredientscinnamon (cinnamomum cassia) bark extract25 mg†phospholipids (from soy lecithin)500mg†of which phosphatidylcholine250 mg†* recommended daily allowance  †rda not established dosage as a dietary supplement take 1-2 sachets per day.higher therapeutic doses may be necessary, take advice from your doctor or health practitioner.if you are pregnant or breastfeeding, consult a healthcare practitioner before using this product.for best results, snip or tear the notched end off the sachet, squeeze the gel contents into a small amount of water or your favourite cool beverage and shot it down quickly.to speed up absorption drink on an empty stomach, and wait at least 15 minutes before eating.if you are prone to low blood sugar levels, it is best to take the altrient b just before a light meal. hypoglycemic substances like caffeine should be avoided for at least 15 minutes after taking the product. storage store in a cool, dry place, can be refrigerated.do not freeze or place the product in direct sunlight for extended periods of time.https://redsupps.co.uk/products/altrient-b-liposomal-vitamin-bhttps://cdn.shopify.com/s/files/1/2544/1734/products/altrient-b-liposomal-vitamin-b-complex_600x600_crop_center.jpg?v=1539138801Livon new 710941540403in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsVITAMIN B 54.99GBP shopify_710835404851_8488840101939Altrient c liposomal vitamin c  descriptionmost ordinary forms of oral vitamin c – tablets, capsules, powders, liquids and even dietary sources are not metabolised efficiently due to tightly regulated absorption controls in the body. this means that levels of vitamin c in the intestines reaches saturation point at as little as 200mg. in fact, the more we take in the less we absorb. thus, very little reaches your blood stream let alone the cells where it is needed most. until recently intravenous delivery of vitamin c has proven to be the most effective route for absorption, but this method is both costly and impractical.altrient c offers the perfect solution because of its scientifically proven liposomal delivery method. this powerful form of transportation encapsulates the nutrient in a microscopic phospholipid bubble that carries it within minutes directly to the cells, protecting it from the destructive elements of the digestive system. altrient c is the most effective option for ensuring your body has adequate vitamin c levels.helps maintain normal function of the immune system, promoting overall good health.supports collagen formation for healthy joints, bones, skin, gums, cartilage and blood vessels.supports normal functioning of the nervous system, helping the body to cope with stress.contributes to the reduction of tiredness and fatigue, helping to maintain normal energy levels.helps to protect cells from oxidative stress, plays a key role in wound healing & tissue repair.an independent double-blind, placebo controlled study carried out by princeton consumer research centre, proved a staggering 61.4% increase in skin firmness and elasticity and a reduction in the appearance of fine lines and wrinkles on both the face and body. those given placebo treatment showed no change at all.these incredible results were achieved by taking just 3 sachets of altrient c a day over a 16 week period. at week 8 elasticity had increased by 40%, by week 12 it had reached 60.8% and by week 16 it had risen to 61.4%. of the 41 women that took part ranging from 31 to 61 years old, all said that they would add altrient c to their daily skincare routine."this nutrient boosts collagen production, cleverly protects skin cells from the harmful effects of uv light and assists with skin cell repair and renewal."- susie perry debice, health writer, author and nutritionist  nutritional facts altrient c nutritional facts: 1 sachet (5.7ml) 30 sachet's per boxamount per sachet  % rda*vitamin c (as sodium ascorbate, corn derived)1,000 mg1,250%phospholipids (soy derived)1,000 mg†of which phosphatidylcholine500 mg†* recommended daily allowance  †rda not establishedingredients: deionized water, sodium ascorbate (corn derived), lecithin phospholipids (soy derived), alcohol (ethanol 12% w/w), xanthan gum, citric acid (for ph adjustment).free from: gmo ingredients, sugar, wheat, gluten, yeast, dairy, meat products, hexane, soy protein, artificial colours and flavours. non-acidic and gentle on the stomach. dosage as a dietary supplement take 1-2 sachets per day.higher therapeutic doses may be necessary, take advice from your doctor or health practitioner.if you are pregnant or breastfeeding, consult a healthcare practitioner before using this product.for best results, snip or tear the notched end off the sachet, squeeze the gel contents into a small amount of water or your favourite cool beverage and shot it down quickly.to speed up absorption drink on an empty stomach, and wait at least 15 minutes before eating. storage store in a cool, dry place, can be refrigerated.do not freeze or place the product in direct sunlight for extended periods of time.https://redsupps.co.uk/products/altrient-c-liposomal-vitamin-chttps://cdn.shopify.com/s/files/1/2544/1734/products/altrient-c-liposomal-vitamin-c-by-livon-labs_600x600_crop_center.jpg?v=1539138803Livon new 710835404851in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsVitamin C 39.99GBP shopify_710982926387_8489124266035Altrient gsh liposomal glutathione descriptionmost ordinary forms of glutathione – tablets, capsules, powders, liquids and even dietary sources are of little benefit as they are unable to withstand the digestive processes in the body and absorption levels are poor. until recently intravenous delivery of glutathione has proven to be the most effective route for absorption, but this method is both costly and impractical. fortunately, altrient glutathione uses a clinically proven liposomal glutathione called setria offering significant advantages….setria glutathione is the purest and safest form of glutathione, produced using a patented fermentation process. altrient glutathione is encapsulated within layers of essential phospholipids called liposomes. these form a protective membrane around the contents, allowing almost 100% bio-availability. the tiny liposomal bubbles can by-pass the digestive juices and deliver the glutathione straight to the cells. this oral formula offers a simple and efficient way to increase the body’s levels of glutathione without the inconvenience and cost of intravenous administration.supports liver detoxification and regeneration.helps protect cells from oxidative stress & free radical damage.helps defend against viruses and bacteria, plays a key role in the body's immune responses.helps maintain normal brain function.enhances activation of vitamins e and c for maximum healing power.nature cleverly combines nutrients in food that work together very effectively to provide a multitude of health benefits. as an example, broccoli provides vitamin c, alpha lipoic acid, b vitamins and a whole range of other beneficial compounds. these combined nutrients have a far greater effect on health than an individual nutrient working alone.combining supplements in a similar way ensures that the co-factors needed to stimulate activity of specific nutrients such as vitamin c are available to maximise its effects in the body. with this in mind, we have carefully paired nutrients that have a powerful synergy so we can offer you the perfect combinations for sparkling good health. nutritional facts altrient glutathione nutritional facts: 1 sachet (5.4ml) 30 sachet's per boxamount per sachet  % rda*l-gutathione (reduced form)450 mg†phospholipids (soy derived)1,000 mg†of which phosphatidylcholine500 mg†* recommended daily allowance  †rda not establishedingredients: deionized water, l-glutathione, lecithin phospholipids (soy derived), alcohol (ethanol 12% w/w), xanthan gum.free from: gmo ingredients, sugar, wheat, gluten, yeast, dairy, meat products, hexane, soy protein, artificial colours and flavours. non-acidic and gentle on the stomach. dosage as a dietary supplement take 1-2 sachets per day.higher therapeutic doses may be necessary, take advice from your doctor or health practitioner.if you are pregnant or breastfeeding, consult a healthcare practitioner before using this product.for best results, snip or tear the notched end off the sachet, squeeze the gel contents into a small amount of water or your favourite cool beverage and shot it down quickly.to speed up absorption drink on an empty stomach, and wait at least 15 minutes before eating. storage store in a cool, dry place, can be refrigerated.do not freeze or place the product in direct sunlight for extended periods of time.https://redsupps.co.uk/products/altrient-gsh-liposomal-glutathionehttps://cdn.shopify.com/s/files/1/2544/1734/products/altrient-gsh-liposomal-glutathione-livon-labs_600x600_crop_center.jpg?v=1539138809Livon new 710982926387in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIPOSOMAL GLUTATHIONE 79.99GBP shopify_711023427635_8489286369331Altrient r-ala liposomal r-alpha lipoic acid  descriptionmost ordinary forms of alpha lipoic acid – tablets, capsules, powders and liquids come in the chemically synthesised form of s-lipoic acid (s-la) which is stable and cheap to produce but it’s benefits are limited. altrient uses the form naturally occurring in plants called r-lipoic acid (r-la) which has exceptional health benefits due to its unique fat and water soluble properties.these allow it to work inside and outside of the cells, protecting virtually all body tissues against free radical damage. whilst r-la is proven to be far better absorbed than s-la it is highly unstable and rapidly excreted. fortunately, altrient r-ala has the answer providing a superior form of r-la without compromising on stability. it achieves this by encapsulating r-la into a cleverly designed phospholipid bubble called a liposome. this powerful delivery system manages to withstand all digestive challenges transporting the ala directly into the cells where it’s needed most.enhances cellular protection, playing a vital role in regenerating other antioxidants.helps regulate insulin sensitivity and reduce the effects of diabetic neuropathy.supports liver repair and heavy metal detox.contributes to healthy cardiovascular and reproductive function.supports mitochondrial function helping to reduce excess weight.nature cleverly combines nutrients in food that work together very effectively to provide a multitude of health benefits. as an example, broccoli provides vitamin c, alpha lipoic acid, b vitamins and a whole range of other beneficial compounds. these combined nutrients have a far greater effect on health than an individual nutrient working alone.combining supplements in a similar way ensures that the co-factors needed to stimulate activity of specific nutrients such as vitamin c are available to maximise its effects in the body. with this in mind, we have carefully paired nutrients that have a powerful synergy so we can offer you the perfect combinations for sparkling good health. nutritional facts altrient r-ala nutritional facts: 1 sachet (5.7ml) 30 sachet's per boxamount per sachet  % rda*r-alpha lipoic acid226mg†phospholipids (soy derived)1,000 mg†of which phosphatidylcholine500 mg†* recommended daily allowance  †rda not establishedingredients: deionized water, lecithin phospholipids (soy derived), alcohol (ethanol 12% w/w), adenosiine monophosphate, (natural flavour modifier), r-alpha lipoic acid, natural lemon flavouring, xanthan gum.free from: gmo ingredients, sugar, wheat, gluten, yeast, dairy, meat products, hexane, soy protein, artificial colours and flavours. non-acidic and gentle on the stomach. dosage as a dietary supplement take 1-2 sachets per day.higher therapeutic doses may be necessary, take advice from your doctor or health practitioner.if you are pregnant or breastfeeding, consult a healthcare practitioner before using this product.for best results, snip or tear the notched end off the sachet, squeeze the gel contents into a small amount of water or your favourite cool beverage and shot it down quickly.to speed up absorption drink on an empty stomach, and wait at least 15 minutes before eating. storagestore in a cool, dry place, can be refrigerated.do not freeze or place the product in direct sunlight for extended periods of time.https://redsupps.co.uk/products/altrient-r-ala-liposomal-r-alpha-lipoic-acidhttps://cdn.shopify.com/s/files/1/2544/1734/products/altrient-liposomal-r-alpha-lipoic-acid-livon-labs_600x600_crop_center.jpg?v=1539138820Livon new 711023427635in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIPOSOMAL R-ALPHA LIPOIC ACID 79.99GBP shopify_369641750565_4714184278053Anesthetized benefitsknocks you out fast!allows for muscle recovery descriptionmaking gains isn’t purely about lifting big and eating big, it’s also about sleeping big too! far too often athletes train their tails off but don’t get enough sleep at night, and shortcut their growth potential, thereby limiting their results. ingredientsgetting a full night’s sleep isn’t easy, which is why blackstone labs has created the ultimate formula to knock you out at night and keep you out until morning in anesthetized. 1 scoop of this nighttime recovery and growth formula will have you sleeping like a baby and waking up in the morning ready for another day of crushing it in the gym! directionsas a dietary supplement, take one (1) scoop in 8-12 oz. of water 30 minutes prior to bed tie. due to extreme potency, user may wish to begin by consuming one half (1/2) scoop to assess tolerance.https://redsupps.co.uk/products/blackstone-labs-anesthetized-25-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/anesthetized-pineapple_600x600_crop_center.png?v=1539138823Blackstone Labs new 369641750565out of stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsSleep Aid 35.99GBP shopify_1469488988211_13227387584563Animal pak  descriptionthe true original since 1983, the animal pak was developed to cover the wide backs of the hardest and heaviest trainers on the planet earth. the “ultimate training pack” is far more than a mere multivitamin, but is the trusted, sturdy foundation upon which the most dedicated bodybuilders and powerlifters have built their nutritional regimens, since the supplement industry was in its mere infancy.if you're training or dieting hard for a contest, the first thing that happens when you don't take the animal pak is that nutritional gaps begin to form. why should you care? because over time, these deficiencies continue to grow. eventually, your body will stop functioning at its optimum level. in other words, you hit the wall, your development reaches a plateau. in fact, even if only one key nutrient is missing from your diet, your body could shut down the anabolic drive needed to build muscle so that it can support more critical metabolic processes. when this happens, you stop growing.research has proven that strength athletes such as bodybuilders and powerlifters, due to the intensity and frequency of their training programs, have higher nutritional requirements than regular athletes. studies have shown that these unique needs are greatly increased for bodybuilders who regularly compete and need to diet down. during calorie-restricted diets (diets which tend to be repetitive and monotonous, e.g., rice and chicken), the potential for nutritional deficiencies increase dramatically.more alarming is the fact that championship-caliber bodybuilders, even when supplementing with a regular multivitamin, were still experiencing significant nutritional deficiencies. a basic multivitamin supplement won't be enough. competitive bodybuilders know that a superior multivitamin is the first line of defense. this fact is confirmed by studies which have revealed that 100% of olympic weightlifters and over 90% of competitive male and female bodybuilders use a vitamin/mineral supplement like animal pak.these nutritional gaps not only affect your performance and size, but they begin to impact the way your other supplements work. for many of today's supplements to work efficiently, your body needs to be running on all cylinders. nutritional gaps mean that your supplements may be rendered ineffective. for example, many supplements rely on enzymes and other substances in your body to "activate" them. poor nutrition means poor conversion and activation of expensive supplements. animal pak is your insurance policy to prevent this from happening. the pak helps ensure you are maintaining an anabolic internal environment, one primed for muscle growth and optimum performance.with animal pak, you get plenty of everything you need. and a few extras. in every pack, you get a vast arsenal of over 60 key ingredients that are delivered in the right amounts at the right time, every time. each of the 11 tablets included in each pack has been specifically formulated to deliver the goods—ample doses of vitamins, minerals, amino acids, herbs and other performance optimizers designed to stand up to the most intense training and rigorous dieting.consider the animal pak as the cast iron skillet of your supplement program, your body's first line of defense. if you train with weights, then you absolutely need to train with the animal pak. remember, while most supplements have come and gone, precious few have stood the test of time. when you're ready for the best, step up to the most trusted name in serious bodybuilding nutrition: animal pak. what ifbb pros and mr. olympia competitors have used since '83. what the best of the best depend on, when the going gets tough, and every set, rep and meal matters the most.. the legendary animal pak.https://redsupps.co.uk/products/animal-pakhttps://cdn.shopify.com/s/files/1/2544/1734/products/Animal_Pak_i2380_d1200x1200_600x600_crop_center.jpg?v=1539197352Universal Nutrition new 1469488988211in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMultivitamin 29.99GBP shopify_369643716645_5020634775589Anogenin benefitsincreases strengthsafe for women descriptionevery hard-training athlete wants to make gains in the performance and physique, but not every athlete wants to jump head first into the world of anabolics, where the rewards are monumental, but so are the risks. blackstone labs realizes that all athletes want to build muscle and increase performance and have created the ultimate all-natural muscle building supplement in anogenin.anogenin is a non-hormonal muscle builder to enhance strength, recovery, and lean muscle mass as well as decrease body fat levels. anogenin is perfect for men and women as it won’t affect your hormone levels, but will significantly enhance your performance and physique. ingredients5 alpha hydroxy laxogenin (25mg) commonly referred to as laxogenin or “laxo” for short, 5 alpha hydroxy laxogenin is an all-natural, plant-based steroid shown to enhance protein synthesis by over 200%! anogenin doesn’t affect natural testosterone production (meaning there’s no need for post cycle therapy), but will significantly increase strength, power, performance, and body composition in as little as 2-3 weeks! natty or not, anogenin belongs in any muscle-building stack. directionsas a dietary supplement, take one (1) capsule two (2) times per day with food. do not take more than two (2) capsules per day. use in cycles of 8-12 weeks, taking at least 4 weeks off between cycle. this product does not require a pct.https://redsupps.co.uk/products/blackstone-labs-anogenin-60caps-anabolic-activator-natural-lean-muscle-gainshttps://cdn.shopify.com/s/files/1/2544/1734/products/anogenin_600x600_crop_center.png?v=1539138826Blackstone Labs new 369643716645in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Builder 39.99GBP shopify_369643356197_4714190143525Apex male benefitsnatural test boosterincreases sexual health descriptionbeginning at age 30, men experience a gradual, and consistent, decline in testosterone production. declining testosterone levels means it’s harder to build muscle, and a whole lot easier to gain fat. until now, the aging male faced two choices, neither ideal -- suffer the incessant drop in testosterone, or embrace testosterone replacement therapy.blackstone labs has developed a third option, one that restores optimal testosterone production without resorting to chemicals, pharmaceuticals, patches, or injections. apex male is a revolutionary, all-natural testosterone booster any man can use to restore health, vigor, and vitality. it’s the daily staple all men over 30 need to boost testosterone production and bring out the alpha male. ingredientsd-aspartic acid (1500mg) daa is an amino acid documented to enhance gonadotropin releasing hormone as well as growth hormone (gh) and luteinizing hormone (lh). additional research on this muscle-building amino shows it can directly increase testosterone production by the testesbulbine natalensis (500mg) long used as an aphrodisiac by ancient peoples, bulbine has some incredible research showing it can increase serum testosterone levels, follicle-stimulating hormone (fsh), luteinizing hormone (lh), and even testicle size! what’s more, bulbine has also been shown to reduce estrogen levels in the body, creating the ultimate anabolic environment in your body.fenugreek extract (125mg) is extremely well known in the ayurveda and has been used as a tonic to aid everything from fever to diabetes. it’s also a proven testosterone boosting ingredient too! fenugreek is believed to inhibit aromatase activity, thereby enhancing testosterone levels and while also decreasing body fat.tribulus terrestris (125mg) is another incredibly popular and well-researched ayurvedic herb used to enhance male virility/vitality. research shows that tribulus can increase igf-1 and testosterone and enhance lean body mass, while also reducing body fat.maca extract (125mg) potent botanical traditionally used by peruvian men to enhance performance and stamina. modern research shows that maca can indeed boost libido, sexual desire, and fertility.l-tyrosine (125mg) a nonessential amino acid the body uses to produce the important neurotransmitter dopamine. in addition to enhancing mood, increased dopamine production also kickstarts a series of physiological processes culminating in greater natural testosterone production. suffice it to say this is one nonessential amino that is absolutely essential to optimal testosterone levels!dim (100mg) short for diindolylmethane, dim is a powerful anti-estrogen compound present in cruciferous vegetables, such as broccoli or cauliflower. dim supports hormonal homeostasis in the body by increasing more of the “good” estrogens and decreasing the “bad” estrogens.prunella vulgaris (75mg) commonly used chinese herb, that’s also known as self-heal. prunella vulgaris is edible and typically consumed in salads or brewed as a tea. it’s also a powerful antiestrogenic ingredient that reduce estrogen levels through activation of the ahr (aryl hydrocarbon receptor) receptor.epimedium extract (75mg) more commonly known as “horny goat weed”, epimedium is a plant found across asia and the mediterranean traditionally used as an aphrodisiac. it’s rich in a compound called icariin which blocks the activity of a pde5, an enzyme that interferes with nitric oxide production. supplementing with icariin can enhance no delivery and blood flow to sexual organs, enhancing performance and stamina.n-methyl d-aspartate (15mg) derivative of d-aspartic acid shown to be 100x more potent than regular daa. as a more potent, and more water-soluble form of daa, nmda should trigger substantial muscle growth and testosterone production at a fraction of the required daa dose.bioperine (5mg) patented form of piperine, a black pepper extract included to enhance the bioavailability and utilization of all the testosterone-boosting compounds in apex male, ensuring you get maximum effectiveness from every dose.vitamin d3 (1250iu) plays a critical role in testosterone production and overall health. research shows that men deficient in this essential vitamin have higher body fat and estrogen levels along with lower lean mass and reduced fertility. directionsas a dietary supplement, take four (4) capsules two (2) times per day with food. apex male is a complete and natural test booster, and requires no cycling or pct. store in a cool, dry place.https://redsupps.co.uk/products/blackstone-labs-apex-male-240caps-great-test-booster-huge-gains-complete-pcthttps://cdn.shopify.com/s/files/1/2544/1734/products/apexmale_790e9d36-64c9-448d-9bd9-6af409095023_600x600_crop_center.png?v=1539138863Blackstone Labs new 369643356197in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsTestosterone Boosters 42.99GBP shopify_1423292629043_12867887595571Apple cider vinegar 946 ml benefitscontains the "mother"apple cider vinegar diluted to 5% acidityunpasteurizednaturally gluten freemade from organic apples descriptionbragg organic apple cider vinegar is made from delicious, healthy, organically grown apples and is the wholesome way to add delicious flavour to most foods. unfiltered, unheated and unpasteurized, bragg apple cider vinegar has just 5% acidity and is full of zesty natural goodness.bragg organic apple cider vinegar contains the amazing 'mother of vinegar' which occurs naturally as strand-like enzymes of connected protein molecules. it is processed and bottled in accordance with usda guidelines. ingredientscertified organic raw apple cider vinegar and purified water, diluted to 5% acidityhttps://redsupps.co.uk/products/apple-cider-vinegar-946-mlhttps://cdn.shopify.com/s/files/1/2544/1734/products/26368_600x600_crop_center.jpg?v=1539138867Bragg new 1423292629043in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsApple Cider Vinegar 10.99GBP shopify_691176046643_8412844195891Basic pct stack stacks automatically discounted 10% or morewhat's included?eradicategear supportpctvhttps://redsupps.co.uk/products/basic-pct-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/pct-stack-basic_1024x_1c517744-7660-4009-a872-dd0bb3b37ecd_600x600_crop_center.png?v=1539138869Blackstone Labs new 691176046643out of stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsBasic PCT Stack 93.99GBP shopify_369644797989_4714193158181Bcaa resurgence benefitsall day supplementationpacked with amino acids descriptionwhen you’re primary concern is building muscle, there’s a few things you need to focus on each day -- eating ample calories, training intensely by following the principles of progressive overload, resting enough. but sometimes that’s not enough. sometimes your body is missing those key nutrients it needs throughout the day to repair, replenish and rebuild your mind and muscles.resurgence is your all day, every day muscle-building insurance policy that provides the essential amino acids, vitamins, and minerals to promote optimal muscle growth and recovery. also included is a powerful focus matrix including proven nootropics to obliterate mental fatigue and promote long-lasting focus and concentration all day long.say goodbye to soreness, achiness, lethargy, and lackluster gains once and for all with resurgence! ingredientshica scientifically known as alpha-hydroxy-isocaproic-acid, or leucic acid, hica is a metabolite of the leucine that works in conjunction with other active amino acids present in resurgence to stimulate muscle growth and accelerate recovery.theobrominea relative of caffeine, theobromine is a xanthine-like molecule that stimulates the cns similar to caffeine but energy surge is much smoother and longer-lasting. additionally, theobromine also enhances vasodilation, promoting superior cerebral blood flow for greater focus and concentration.cdp-choline choline is an essential nutrient that plays a critical role in gene expression, cell membrane signaling, lipid transport, metabolism, and brain development. cdp-choline is a highly bioavailable form of supplemental choline that increases synthesis of acetylcholine (a.k.a. “the learning neurotransmitter). higher levels of acetylcholine promote greater focus, concentration, and the ever-important mind-muscle connection during exercise.l-leucine (2g) dubbed the “king” of all amino acids, leucine is one of the three branched-chain amino acids, along with isoleucine and valine, that plays a key role in muscle growth. leucine is the primary stimulator of muscle protein synthesis by activating the mtor pathway which flips the switch in your body to build muscle.l-isoleucine (1g) another one of the bcaas that can stimulate muscle protein synthesis, but to a lesser extent than leucine. however, isoleucine does play a significant role in glucose uptake and utilization during exercise, resulting in greater energy production and performance. isoleucine may also play a role in fat loss, as some research indicates the amino acid inhibits fat storage and increases fat burning.l-valine (1g) the third bcaa, valine supports greater endurance and reduced fatigue while training. valine competes with tryptophan (another amino acid) for uptake into the brain (and wins!), leading to decreased serotonin production. the brain interprets serotonin as an indicator of fatigue, so with less serotonin, you’ll be able to push harder for longer during your lifting sessions.l-lysine (1mg) supports the production of carnitine, a compound that helps convert fatty acids into useable energy. lysine also enhances calcium absorption, and works in conjunction with l-arginine to increase growth hormone (gh) production.l-taurine (1g) a conditionally essential amino acid, taurine exerts a number of beneficial effects in the body. taurine enhances cellular hydration, promoting greater endurance and stamina, and also improves mood and focus due to large concentrations of the amino being present in the brain.threonine (950mg) supports optimal functioning of the cardiovascular, liver, central nervous, and immune systems of the body. research notes that threonine also helps maintain the protein balance in the body and accelerate recovery from an injury.l-alanine (500mg) plays a crucial role in protein synthesis, even though it’s classified as a nonessential amino acid. additionally, alanine can also convert to pyruvate, a compound essential for glucose production and blood sugar regulation.methionine (300mg) vital to the production of creatine and carnitine in the body. as a result, this essential amino acid aids energy production, athletic performance, cellular hydration, and most importantly, lean mass gains..phenylalanine (150mg) as a precursor to tyrosine, phenylalanine increases production of three key neurotransmitters -- dopamine, epinephrine, and adrenaline. these three neurotransmitters enhance alertness and mood, and serve a critical role in muscle activation. instructionsfor an amino acid boost, take one (1) scoop first thing in the morning.for pre-workout energy, take one (1) to two (2) scoops 30 minutes before training.for post-workout recovery, take one (1) to two (2) scoops immediately after training.https://redsupps.co.uk/products/blackstone-labs-resurgence-bcaa-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/bcaaresurgence-pinacolada-purple_600x600_crop_center.png?v=1539138870Blackstone Labs new 369644797989in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsBCAA 29.00GBP shopify_369644797989_4714193190949Bcaa resurgence benefitsall day supplementationpacked with amino acids descriptionwhen you’re primary concern is building muscle, there’s a few things you need to focus on each day -- eating ample calories, training intensely by following the principles of progressive overload, resting enough. but sometimes that’s not enough. sometimes your body is missing those key nutrients it needs throughout the day to repair, replenish and rebuild your mind and muscles.resurgence is your all day, every day muscle-building insurance policy that provides the essential amino acids, vitamins, and minerals to promote optimal muscle growth and recovery. also included is a powerful focus matrix including proven nootropics to obliterate mental fatigue and promote long-lasting focus and concentration all day long.say goodbye to soreness, achiness, lethargy, and lackluster gains once and for all with resurgence! ingredientshica scientifically known as alpha-hydroxy-isocaproic-acid, or leucic acid, hica is a metabolite of the leucine that works in conjunction with other active amino acids present in resurgence to stimulate muscle growth and accelerate recovery.theobrominea relative of caffeine, theobromine is a xanthine-like molecule that stimulates the cns similar to caffeine but energy surge is much smoother and longer-lasting. additionally, theobromine also enhances vasodilation, promoting superior cerebral blood flow for greater focus and concentration.cdp-choline choline is an essential nutrient that plays a critical role in gene expression, cell membrane signaling, lipid transport, metabolism, and brain development. cdp-choline is a highly bioavailable form of supplemental choline that increases synthesis of acetylcholine (a.k.a. “the learning neurotransmitter). higher levels of acetylcholine promote greater focus, concentration, and the ever-important mind-muscle connection during exercise.l-leucine (2g) dubbed the “king” of all amino acids, leucine is one of the three branched-chain amino acids, along with isoleucine and valine, that plays a key role in muscle growth. leucine is the primary stimulator of muscle protein synthesis by activating the mtor pathway which flips the switch in your body to build muscle.l-isoleucine (1g) another one of the bcaas that can stimulate muscle protein synthesis, but to a lesser extent than leucine. however, isoleucine does play a significant role in glucose uptake and utilization during exercise, resulting in greater energy production and performance. isoleucine may also play a role in fat loss, as some research indicates the amino acid inhibits fat storage and increases fat burning.l-valine (1g) the third bcaa, valine supports greater endurance and reduced fatigue while training. valine competes with tryptophan (another amino acid) for uptake into the brain (and wins!), leading to decreased serotonin production. the brain interprets serotonin as an indicator of fatigue, so with less serotonin, you’ll be able to push harder for longer during your lifting sessions.l-lysine (1mg) supports the production of carnitine, a compound that helps convert fatty acids into useable energy. lysine also enhances calcium absorption, and works in conjunction with l-arginine to increase growth hormone (gh) production.l-taurine (1g) a conditionally essential amino acid, taurine exerts a number of beneficial effects in the body. taurine enhances cellular hydration, promoting greater endurance and stamina, and also improves mood and focus due to large concentrations of the amino being present in the brain.threonine (950mg) supports optimal functioning of the cardiovascular, liver, central nervous, and immune systems of the body. research notes that threonine also helps maintain the protein balance in the body and accelerate recovery from an injury.l-alanine (500mg) plays a crucial role in protein synthesis, even though it’s classified as a nonessential amino acid. additionally, alanine can also convert to pyruvate, a compound essential for glucose production and blood sugar regulation.methionine (300mg) vital to the production of creatine and carnitine in the body. as a result, this essential amino acid aids energy production, athletic performance, cellular hydration, and most importantly, lean mass gains..phenylalanine (150mg) as a precursor to tyrosine, phenylalanine increases production of three key neurotransmitters -- dopamine, epinephrine, and adrenaline. these three neurotransmitters enhance alertness and mood, and serve a critical role in muscle activation. instructionsfor an amino acid boost, take one (1) scoop first thing in the morning.for pre-workout energy, take one (1) to two (2) scoops 30 minutes before training.for post-workout recovery, take one (1) to two (2) scoops immediately after training.https://redsupps.co.uk/products/blackstone-labs-resurgence-bcaa-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/bcaaresurgence-pinacolada-purple_600x600_crop_center.png?v=1539138870Blackstone Labs new 369644797989in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsBCAA 29.00GBP shopify_369644797989_6992712138803Bcaa resurgence benefitsall day supplementationpacked with amino acids descriptionwhen you’re primary concern is building muscle, there’s a few things you need to focus on each day -- eating ample calories, training intensely by following the principles of progressive overload, resting enough. but sometimes that’s not enough. sometimes your body is missing those key nutrients it needs throughout the day to repair, replenish and rebuild your mind and muscles.resurgence is your all day, every day muscle-building insurance policy that provides the essential amino acids, vitamins, and minerals to promote optimal muscle growth and recovery. also included is a powerful focus matrix including proven nootropics to obliterate mental fatigue and promote long-lasting focus and concentration all day long.say goodbye to soreness, achiness, lethargy, and lackluster gains once and for all with resurgence! ingredientshica scientifically known as alpha-hydroxy-isocaproic-acid, or leucic acid, hica is a metabolite of the leucine that works in conjunction with other active amino acids present in resurgence to stimulate muscle growth and accelerate recovery.theobrominea relative of caffeine, theobromine is a xanthine-like molecule that stimulates the cns similar to caffeine but energy surge is much smoother and longer-lasting. additionally, theobromine also enhances vasodilation, promoting superior cerebral blood flow for greater focus and concentration.cdp-choline choline is an essential nutrient that plays a critical role in gene expression, cell membrane signaling, lipid transport, metabolism, and brain development. cdp-choline is a highly bioavailable form of supplemental choline that increases synthesis of acetylcholine (a.k.a. “the learning neurotransmitter). higher levels of acetylcholine promote greater focus, concentration, and the ever-important mind-muscle connection during exercise.l-leucine (2g) dubbed the “king” of all amino acids, leucine is one of the three branched-chain amino acids, along with isoleucine and valine, that plays a key role in muscle growth. leucine is the primary stimulator of muscle protein synthesis by activating the mtor pathway which flips the switch in your body to build muscle.l-isoleucine (1g) another one of the bcaas that can stimulate muscle protein synthesis, but to a lesser extent than leucine. however, isoleucine does play a significant role in glucose uptake and utilization during exercise, resulting in greater energy production and performance. isoleucine may also play a role in fat loss, as some research indicates the amino acid inhibits fat storage and increases fat burning.l-valine (1g) the third bcaa, valine supports greater endurance and reduced fatigue while training. valine competes with tryptophan (another amino acid) for uptake into the brain (and wins!), leading to decreased serotonin production. the brain interprets serotonin as an indicator of fatigue, so with less serotonin, you’ll be able to push harder for longer during your lifting sessions.l-lysine (1mg) supports the production of carnitine, a compound that helps convert fatty acids into useable energy. lysine also enhances calcium absorption, and works in conjunction with l-arginine to increase growth hormone (gh) production.l-taurine (1g) a conditionally essential amino acid, taurine exerts a number of beneficial effects in the body. taurine enhances cellular hydration, promoting greater endurance and stamina, and also improves mood and focus due to large concentrations of the amino being present in the brain.threonine (950mg) supports optimal functioning of the cardiovascular, liver, central nervous, and immune systems of the body. research notes that threonine also helps maintain the protein balance in the body and accelerate recovery from an injury.l-alanine (500mg) plays a crucial role in protein synthesis, even though it’s classified as a nonessential amino acid. additionally, alanine can also convert to pyruvate, a compound essential for glucose production and blood sugar regulation.methionine (300mg) vital to the production of creatine and carnitine in the body. as a result, this essential amino acid aids energy production, athletic performance, cellular hydration, and most importantly, lean mass gains..phenylalanine (150mg) as a precursor to tyrosine, phenylalanine increases production of three key neurotransmitters -- dopamine, epinephrine, and adrenaline. these three neurotransmitters enhance alertness and mood, and serve a critical role in muscle activation. instructionsfor an amino acid boost, take one (1) scoop first thing in the morning.for pre-workout energy, take one (1) to two (2) scoops 30 minutes before training.for post-workout recovery, take one (1) to two (2) scoops immediately after training.https://redsupps.co.uk/products/blackstone-labs-resurgence-bcaa-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/bcaaresurgence-pinacolada-purple_600x600_crop_center.png?v=1539138870Blackstone Labs new 369644797989in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsBCAA 29.00GBP shopify_734003363891_8712907325491Biovape revolutionary delivery systembiovape breathable vitamins utilize a revolutionary new delivery system that allows for maximum new bioavailability and absorption of your vitamins through aromatherapy rather than ingestion. fact is, we don’t absorb everything we ingest, but breathing in your vitamins allows for fast delivery to the bloodstream.vitamin packed & potentbiovape’s vitamin b12 is an extremely potent source of vegan vitamin b12. due to the unique delivery method of aromatherapy, this aromatherapy supplement allows for less supplement to be used to get the same desired effect.maximize your servings|1 serving of biovape b12 contains 8,333% of the percent daily value of vitamin b12. one serving is 5-10 normal sized breaths, and each vape pen contains about 28 servings.great taste and flavorwith high-quality r&d, biovape features an incredible tasting citrus flavor. enjoy the taste of your aromatherapy vitamins daily!perfect for vegansbiovape b12 is perfect for vegans who need to supplement vitamin b12 into their diet due to a lack of meat. biovape contains absolutely no nicotine, no caffeine, and has no calories.https://redsupps.co.uk/products/biovapehttps://cdn.shopify.com/s/files/1/2544/1734/products/1_transp_600x600_crop_center.png?v=1539138876Biovape new 734003363891in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsBreathable Vitamins 19.99GBP shopify_522463838259_7019761598515Blo benefitsmind blowing pumps †vascularity / fullness †nutrient absorption †stim-free formula †as our standards are constantly surpassing new heights in this industry, we knew this product had to be truly different from the industry cliche. with quality ingredients, in clinical servings, all formulated under one lid, blo® is designed to induce mind blowing pumps, vascularity and explosive strength. you may take blo® as a standalone product or even stack with loco® if desired!https://redsupps.co.uk/products/blohttps://cdn.shopify.com/s/files/1/2544/1734/products/2018-BLO-MOCKUP_1024x_e81e9361-5270-4c32-8b77-aa7c5ae70765_600x600_crop_center.jpg?v=1539138879MYOBLOX new 522463838259in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 37.99GBP shopify_522463838259_8710103203891Blo benefitsmind blowing pumps †vascularity / fullness †nutrient absorption †stim-free formula †as our standards are constantly surpassing new heights in this industry, we knew this product had to be truly different from the industry cliche. with quality ingredients, in clinical servings, all formulated under one lid, blo® is designed to induce mind blowing pumps, vascularity and explosive strength. you may take blo® as a standalone product or even stack with loco® if desired!https://redsupps.co.uk/products/blohttps://cdn.shopify.com/s/files/1/2544/1734/products/2018-BLO-MOCKUP_1024x_e81e9361-5270-4c32-8b77-aa7c5ae70765_600x600_crop_center.jpg?v=1539138879MYOBLOX new 522463838259in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 37.99GBP shopify_522463838259_8710120276019Blo benefitsmind blowing pumps †vascularity / fullness †nutrient absorption †stim-free formula †as our standards are constantly surpassing new heights in this industry, we knew this product had to be truly different from the industry cliche. with quality ingredients, in clinical servings, all formulated under one lid, blo® is designed to induce mind blowing pumps, vascularity and explosive strength. you may take blo® as a standalone product or even stack with loco® if desired!https://redsupps.co.uk/products/blohttps://cdn.shopify.com/s/files/1/2544/1734/products/2018-BLO-MOCKUP_1024x_e81e9361-5270-4c32-8b77-aa7c5ae70765_600x600_crop_center.jpg?v=1539138879MYOBLOX new 522463838259in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 37.99GBP shopify_522463838259_8710136299571Blo benefitsmind blowing pumps †vascularity / fullness †nutrient absorption †stim-free formula †as our standards are constantly surpassing new heights in this industry, we knew this product had to be truly different from the industry cliche. with quality ingredients, in clinical servings, all formulated under one lid, blo® is designed to induce mind blowing pumps, vascularity and explosive strength. you may take blo® as a standalone product or even stack with loco® if desired!https://redsupps.co.uk/products/blohttps://cdn.shopify.com/s/files/1/2544/1734/products/2018-BLO-MOCKUP_1024x_e81e9361-5270-4c32-8b77-aa7c5ae70765_600x600_crop_center.jpg?v=1539138879MYOBLOX new 522463838259in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 37.99GBP shopify_675573891123_8294826410035Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_675573891123_8294883393587Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_675573891123_8294883459123Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_675573891123_8294883491891Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_675573891123_8294883524659Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_675573891123_8294883557427Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_675573891123_8294883590195Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_675573891123_8294883622963Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_675573891123_8294883655731Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_675573891123_8294883688499Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_675573891123_8294883721267Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_675573891123_8294883754035Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_675573891123_8294883786803Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_675573891123_8294883819571Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_675573891123_8294883852339Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_675573891123_8294883885107Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_675573891123_8294883917875Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_675573891123_8294883950643Braun explosion stack stacks automatically discounted 10% or morewhat's included?glycologbcaa resugenceisolation 2lbsformula-19https://redsupps.co.uk/products/braun-explosion-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/braunExplosion_1024x_181cc683-3d3d-4fdf-abdd-fb96da96a936_600x600_crop_center.png?v=1539138882Blackstone Labs new 675573891123in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsExplosion Stack 117.99GBP shopify_369639292965_4714174480421Brutal 4ce brutal 4cewet mass gainsnot liver toxic descriptiongaining mass isn’t easy; it takes years of hard training and big eating. in an ideal world, you’d have all the time in the world to train, eat, and sleep. but you don’t live in a perfect world, you live in a world that demands results now, not 5-10 years from now.brutal 4ce is a serious muscle-builder for serious bodybuilders and athletes looking to pack on the size in a hurry. utilizing the anabolic power of 4-dhea, brutal 4ce will help you add weight to the bar each workout, skyrocket testosterone levels, and build slabs of lean muscle in no time at all.  directionsas a dietary supplement, take one (1) tablet two (2) times per day. do not exceed two (2) tablets daily.https://redsupps.co.uk/products/new-blackstone-labs-brutal-4ce-60tab-serious-muscle-gains-liposomal-deliveryhttps://cdn.shopify.com/s/files/1/2544/1734/products/brutal4ce_7342deea-d3ca-4c4e-b58b-21459c9094ce_600x600_crop_center.png?v=1539138883Blackstone Labs new 369639292965in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Builder 49.99GBP shopify_587829575731_7563126931507Caffeinated peanut powder 400g The irresistible taste of sweet golden honey and roasted peanuts blended into a powder. made from real peanuts but with less fat. supplement your workout and your life with quality protein to feel good and be healthy. this peanut powder is so versatile you can use it in, or on almost anything, reconstituted or as a powder.https://redsupps.co.uk/products/chocolate-chaos-powder-caffeinatedhttps://cdn.shopify.com/s/files/1/2544/1734/products/POWDER-CHOCOLATE-CHAOS_1024x1024_00738c39-7085-431d-9486-96621d864ec8_600x600_crop_center.jpg?v=1539138888Sinister Labs new 587829575731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPeanut Powder 17.00GBP shopify_587829575731_7565063520307Caffeinated peanut powder 400g The irresistible taste of sweet golden honey and roasted peanuts blended into a powder. made from real peanuts but with less fat. supplement your workout and your life with quality protein to feel good and be healthy. this peanut powder is so versatile you can use it in, or on almost anything, reconstituted or as a powder.https://redsupps.co.uk/products/chocolate-chaos-powder-caffeinatedhttps://cdn.shopify.com/s/files/1/2544/1734/products/POWDER-CHOCOLATE-CHAOS_1024x1024_00738c39-7085-431d-9486-96621d864ec8_600x600_crop_center.jpg?v=1539138888Sinister Labs new 587829575731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPeanut Powder 17.00GBP shopify_587829575731_7565063553075Caffeinated peanut powder 400g The irresistible taste of sweet golden honey and roasted peanuts blended into a powder. made from real peanuts but with less fat. supplement your workout and your life with quality protein to feel good and be healthy. this peanut powder is so versatile you can use it in, or on almost anything, reconstituted or as a powder.https://redsupps.co.uk/products/chocolate-chaos-powder-caffeinatedhttps://cdn.shopify.com/s/files/1/2544/1734/products/POWDER-CHOCOLATE-CHAOS_1024x1024_00738c39-7085-431d-9486-96621d864ec8_600x600_crop_center.jpg?v=1539138888Sinister Labs new 587829575731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPeanut Powder 17.00GBP shopify_588107513907_7565561069619Caffeinated protein peanut spread 340g descriptionwhat is better than a fantastic source of protein, blend, quick and a variety of awesome flavours? nothing really…. which is why sinister labs angry mills peanut butter blend is top.  this unique peanut blend contains high quality proteins and is a fantastic energy source to get you through your day! as an athlete if you’re on the go and require a delicious and quick meal packed with protein then this spread is for you! power yourself through those lazy days and acquire protein easier than ever!for the athletes who desire fantastic taste and high-quality macro-nutrients then this is for you!https://redsupps.co.uk/products/caffeinated-protein-peanut-spread-340ghttps://cdn.shopify.com/s/files/1/2544/1734/products/12oz-Chocolate-Craze-Caff_1024x1024_d545215f-4891-4a22-b21c-e7244b8d8ab2_600x600_crop_center.jpg?v=1539138901Sinister Labs new 588107513907in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCaffeinated Protein Peanut Spread 11.99GBP shopify_588107513907_7565561102387Caffeinated protein peanut spread 340g descriptionwhat is better than a fantastic source of protein, blend, quick and a variety of awesome flavours? nothing really…. which is why sinister labs angry mills peanut butter blend is top.  this unique peanut blend contains high quality proteins and is a fantastic energy source to get you through your day! as an athlete if you’re on the go and require a delicious and quick meal packed with protein then this spread is for you! power yourself through those lazy days and acquire protein easier than ever!for the athletes who desire fantastic taste and high-quality macro-nutrients then this is for you!https://redsupps.co.uk/products/caffeinated-protein-peanut-spread-340ghttps://cdn.shopify.com/s/files/1/2544/1734/products/12oz-Chocolate-Craze-Caff_1024x1024_d545215f-4891-4a22-b21c-e7244b8d8ab2_600x600_crop_center.jpg?v=1539138901Sinister Labs new 588107513907in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCaffeinated Protein Peanut Spread 11.99GBP shopify_588107513907_7565561135155Caffeinated protein peanut spread 340g descriptionwhat is better than a fantastic source of protein, blend, quick and a variety of awesome flavours? nothing really…. which is why sinister labs angry mills peanut butter blend is top.  this unique peanut blend contains high quality proteins and is a fantastic energy source to get you through your day! as an athlete if you’re on the go and require a delicious and quick meal packed with protein then this spread is for you! power yourself through those lazy days and acquire protein easier than ever!for the athletes who desire fantastic taste and high-quality macro-nutrients then this is for you!https://redsupps.co.uk/products/caffeinated-protein-peanut-spread-340ghttps://cdn.shopify.com/s/files/1/2544/1734/products/12oz-Chocolate-Craze-Caff_1024x1024_d545215f-4891-4a22-b21c-e7244b8d8ab2_600x600_crop_center.jpg?v=1539138901Sinister Labs new 588107513907in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCaffeinated Protein Peanut Spread 11.99GBP shopify_588107513907_7565561167923Caffeinated protein peanut spread 340g descriptionwhat is better than a fantastic source of protein, blend, quick and a variety of awesome flavours? nothing really…. which is why sinister labs angry mills peanut butter blend is top.  this unique peanut blend contains high quality proteins and is a fantastic energy source to get you through your day! as an athlete if you’re on the go and require a delicious and quick meal packed with protein then this spread is for you! power yourself through those lazy days and acquire protein easier than ever!for the athletes who desire fantastic taste and high-quality macro-nutrients then this is for you!https://redsupps.co.uk/products/caffeinated-protein-peanut-spread-340ghttps://cdn.shopify.com/s/files/1/2544/1734/products/12oz-Chocolate-Craze-Caff_1024x1024_d545215f-4891-4a22-b21c-e7244b8d8ab2_600x600_crop_center.jpg?v=1539138901Sinister Labs new 588107513907in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCaffeinated Protein Peanut Spread 11.99GBP shopify_369641652261_4714184114213Chosen1 chosen1 dry lean gainsno estrogen conversion descriptionthe problem with conventional bulking is that in your effort to increase size and strength, you’re all but guaranteed to increase body fat too. some genetically gifted out there put on less fat than others, but the fact remains if you want to build more muscle, you’re stuck with added fat.but not anymore. now you have the choice to build as much lean mass as you want, without the added fat, with the chosen 1. this revolutionary muscle-building supplement is for the aggressive athlete looking to maximize lean gains but minimize fat gain. chosen 1 harnesses the power of 1-dhea, a compound proven to boost size, strength, and aggression.  directionsas a dietary supplement, take one (1) tablet two (2) times per day. do not exceed two (2) tablets daily.https://redsupps.co.uk/products/new-blackstone-labs-chosen-1-60tab-lean-dry-gains-gym-aggression-liposomalhttps://cdn.shopify.com/s/files/1/2544/1734/products/chosen1_600x600_crop_center.png?v=1539138988Blackstone Labs new 369641652261in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Builder 49.99GBP shopify_733984456755_8712096415795Contra benefitsstrength gains †ripped physique †suppress cortisol †estrogen and cortisol are the last hormones we want abundantly present in our body when trying to build a ripped hard physique. when these two hormones are unfavorably balanced, the body undergoes changes that can result in a soft bloated appearance and weaken performance in and out of the gym. another big problem that stems from these specific hormones is that belly fat (as well as any stubborn fat) becomes virtually impossible to lose which can hinder progression in your sport as well as your personal body composition goals. this is a big, yet surprisingly common obstacle that gym enthusiasts and even the most serious athletes have to hurdle over. in comes contra®, a novel aromatase inhibitor and cortisol suppressing king. by reducing the levels of harmful estrogen metabolites and cortisol circulating in the body can in turn promote a healthy balance of testosterone supporting gains in ripped hard muscle.†https://redsupps.co.uk/products/contrahttps://cdn.shopify.com/s/files/1/2544/1734/products/CONTRA-MOCKUP_600x600_crop_center.jpg?v=1539139000MYOBLOX new 733984456755in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCycle Support 39.99GBP shopify_520029438003_6992302964787Crit 30 caps crit is a high quality nootropic that will greatly improve focus and boost your energy. taken 30 minutes before you game, crit will increase your apm, last hits, accuracy, and overall awareness.what in crit gives you energy?caffeine anhydrous 200mgcaffeine like you'd find in monster, red bull, or coffee... except we have 3x the amount per serving.caffeine is the most popular and well known psychoactive drug. it's commonly found in coffee, tea, energy drinks, soft drinks and even chocolate. caffeine seems to have acute cognitive effects. it seems to be able to consistently increase alertness and attention.l-theanine 200mga stimulant most commonly found in tea, which pairs up very well with caffeine anhydrous to kick your ass.l-theanine is one of the main psychoactive compounds found in tea. l-theanine is extremely safe and has been shown to mitigate the negative aspects of caffeine, such as anxiety, increased blood pressure and diminished sleep quality, while possibly improving upon the positive aspects. its ability to enhance attention has been repeatedly verified.black pepper extract (bioperine®) 25mghelps your body to better absorb and utilize other ingredients.black pepper has been used in the human diet since ancient times and is one of the most widely used spices throughout the world. it has also been used in various traditional medicines, preservatives and health supplements. bioperine® should be co-administered with various nutrients to enhance their bioavailability. in general, black pepper extract was found to enhance absorption of nutrients by at least 30%.what in crit helps you focus?alpha-gpc 245mg enhances concentration and learning ability. standard doses start at 100mg per serving. we've nearly tripled that amount to ensure success.alpha-gpc (choline alphoscerate) is a highly bioavailable choline source. alpha-gpc is a product of lecithin commonly found in food and is a natural component of human breast milk. it's also present in brain tissue as a product of phospholipid metabolism. after oral consumption, alpha-gpc is converted to phosphorylcholine which can increase acetylcholine synthesis and release.huperzine a 25mcgenhances mental intake and memory. practice makes perfect. be more perfecter.huperzine a is a naturally occurring acetylcholinesterase inhibitor found in huperzia serrata. huperzia serrata has a long history of use in traditional chinese medicine where it was used for fever, inflammation, muscle strains and rheumatologic conditions. like other acetylcholinesterase inhibitors, there's evidence to suggest huperzine a can be used to help treat alzheimer's disease.https://redsupps.co.uk/products/crit-30capshttps://cdn.shopify.com/s/files/1/2544/1734/products/crit-capsule_1500x_629cc625-6486-4a8f-b295-e340291e3dba_600x600_crop_center.jpg?v=1539139013Good Game Labs new 520029438003in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsGaming Nootropics 29.00GBP shopify_520041562163_6992401956915Crit berry lemonade what in crit gives you energy?caffeine anhydrous 200mgcaffeine like you'd find in monster, red bull, or coffee... except we have 3x the amount per serving.caffeine is the most popular and well known psychoactive drug. it's commonly found in coffee, tea, energy drinks, soft drinks and even chocolate. caffeine seems to have acute cognitive effects. it seems to be able to consistently increase alertness and attention.l-theanine 200mga stimulant most commonly found in tea, which pairs up very well with caffeine anhydrous to kick your ass.l-theanine is one of the main psychoactive compounds found in tea. l-theanine is extremely safe and has been shown to mitigate the negative aspects of caffeine, such as anxiety, increased blood pressure and diminished sleep quality, while possibly improving upon the positive aspects. its ability to enhance attention has been repeatedly verified.black pepper extract (bioperine®) 25mghelps your body to better absorb and utilize other ingredients.black pepper has been used in the human diet since ancient times and is one of the most widely used spices throughout the world. it has also been used in various traditional medicines, preservatives and health supplements. bioperine® should be co-administered with various nutrients to enhance their bioavailability. in general, black pepper extract was found to enhance absorption of nutrients by at least 30%.crit is a high quality nootropic that will greatly improve focus and boost your energy. taken 30 minutes before you game, crit will increase your apm, last hits, accuracy, and overall awareness. what in crit helps you focus?alpha-gpc 245mg enhances concentration and learning ability. standard doses start at 100mg per serving. we've nearly tripled that amount to ensure success.alpha-gpc (choline alphoscerate) is a highly bioavailable choline source. alpha-gpc is a product of lecithin commonly found in food and is a natural component of human breast milk. it's also present in brain tissue as a product of phospholipid metabolism. after oral consumption, alpha-gpc is converted to phosphorylcholine which can increase acetylcholine synthesis and release.huperzine a 25mcgenhances mental intake and memory. practice makes perfect. be more perfecter.huperzine a is a naturally occurring acetylcholinesterase inhibitor found in huperzia serrata. huperzia serrata has a long history of use in traditional chinese medicine where it was used for fever, inflammation, muscle strains and rheumatologic conditions. like other acetylcholinesterase inhibitors, there's evidence to suggest huperzine a can be used to help treat alzheimer's disease.https://redsupps.co.uk/products/crit-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/crit-powder_1500x_2f829612-619d-4031-8ee0-6617a2333d21_600x600_crop_center.jpg?v=1539139015Good Game Labs new 520041562163in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsGaming Nootropics 29.00GBP shopify_369643290661_12933256282163Dust v2 benefitsintense pre-workout formulafive great tasting flavors descriptiondust v2 is a hardcore preworkout that greatly increases energy to improve strength, focus, and athletic performance. available in five flavors, dust v2 is sure to leave a great taste in even the most advanced gym goer's mouth.  instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/blackstone-labs-dust-v2-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/blackstone-labs-dust-v2-30-serve-pineapple-800px_600x600_crop_center.jpg?v=1539139018Blackstone Labs new 369643290661in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 29.99GBP shopify_369643290661_12933274894387Dust v2 benefitsintense pre-workout formulafive great tasting flavors descriptiondust v2 is a hardcore preworkout that greatly increases energy to improve strength, focus, and athletic performance. available in five flavors, dust v2 is sure to leave a great taste in even the most advanced gym goer's mouth.  instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/blackstone-labs-dust-v2-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/blackstone-labs-dust-v2-30-serve-pineapple-800px_600x600_crop_center.jpg?v=1539139018Blackstone Labs new 369643290661in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 29.99GBP shopify_369643290661_12933274927155Dust v2 benefitsintense pre-workout formulafive great tasting flavors descriptiondust v2 is a hardcore preworkout that greatly increases energy to improve strength, focus, and athletic performance. available in five flavors, dust v2 is sure to leave a great taste in even the most advanced gym goer's mouth.  instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/blackstone-labs-dust-v2-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/blackstone-labs-dust-v2-30-serve-pineapple-800px_600x600_crop_center.jpg?v=1539139018Blackstone Labs new 369643290661in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 29.99GBP shopify_369643290661_12933274959923Dust v2 benefitsintense pre-workout formulafive great tasting flavors descriptiondust v2 is a hardcore preworkout that greatly increases energy to improve strength, focus, and athletic performance. available in five flavors, dust v2 is sure to leave a great taste in even the most advanced gym goer's mouth.  instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/blackstone-labs-dust-v2-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/blackstone-labs-dust-v2-30-serve-pineapple-800px_600x600_crop_center.jpg?v=1539139018Blackstone Labs new 369643290661in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 29.99GBP shopify_369643290661_12933274992691Dust v2 benefitsintense pre-workout formulafive great tasting flavors descriptiondust v2 is a hardcore preworkout that greatly increases energy to improve strength, focus, and athletic performance. available in five flavors, dust v2 is sure to leave a great taste in even the most advanced gym goer's mouth.  instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/blackstone-labs-dust-v2-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/blackstone-labs-dust-v2-30-serve-pineapple-800px_600x600_crop_center.jpg?v=1539139018Blackstone Labs new 369643290661in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 29.99GBP shopify_369643290661_12933275025459Dust v2 benefitsintense pre-workout formulafive great tasting flavors descriptiondust v2 is a hardcore preworkout that greatly increases energy to improve strength, focus, and athletic performance. available in five flavors, dust v2 is sure to leave a great taste in even the most advanced gym goer's mouth.  instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/blackstone-labs-dust-v2-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/blackstone-labs-dust-v2-30-serve-pineapple-800px_600x600_crop_center.jpg?v=1539139018Blackstone Labs new 369643290661in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 29.99GBP shopify_369643290661_12933275058227Dust v2 benefitsintense pre-workout formulafive great tasting flavors descriptiondust v2 is a hardcore preworkout that greatly increases energy to improve strength, focus, and athletic performance. available in five flavors, dust v2 is sure to leave a great taste in even the most advanced gym goer's mouth.  instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/blackstone-labs-dust-v2-30-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/blackstone-labs-dust-v2-30-serve-pineapple-800px_600x600_crop_center.jpg?v=1539139018Blackstone Labs new 369643290661in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 29.99GBP shopify_431323021349_5034234347557Dust x dust x extreme pre-workout150mg of 2-aminoisoheptaneimproved flavoring descriptionheading into the gym you should be focused on one thing and one thing only -- complete and utter destruction of the iron. to get your mind and muscles prepared for the impending battle with the weights, you need a pre workout that emboldens you with the fire of 1,000 suns and the energy of a supernova. you need a cutting-edge pre workout that will push you to the utmost extreme and then a little more.you need dust x!dust x is the single most powerful and explosive pre workout ever formulated. each scoop delivers intense, long-lasting energy and sleeve-splitting pumps that will make you never want to leave the gym. hardcore training demands a hardcore pre workout, and for that the only option is dust x! instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/dust-extremehttps://cdn.shopify.com/s/files/1/2544/1734/products/dustX-sourgummybear_600x600_crop_center.png?v=1539139021Blackstone Labs new 431323021349in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 35.99GBP shopify_431323021349_5034234380325Dust x dust x extreme pre-workout150mg of 2-aminoisoheptaneimproved flavoring descriptionheading into the gym you should be focused on one thing and one thing only -- complete and utter destruction of the iron. to get your mind and muscles prepared for the impending battle with the weights, you need a pre workout that emboldens you with the fire of 1,000 suns and the energy of a supernova. you need a cutting-edge pre workout that will push you to the utmost extreme and then a little more.you need dust x!dust x is the single most powerful and explosive pre workout ever formulated. each scoop delivers intense, long-lasting energy and sleeve-splitting pumps that will make you never want to leave the gym. hardcore training demands a hardcore pre workout, and for that the only option is dust x! instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/dust-extremehttps://cdn.shopify.com/s/files/1/2544/1734/products/dustX-sourgummybear_600x600_crop_center.png?v=1539139021Blackstone Labs new 431323021349in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 35.99GBP shopify_431323021349_7774737268787Dust x dust x extreme pre-workout150mg of 2-aminoisoheptaneimproved flavoring descriptionheading into the gym you should be focused on one thing and one thing only -- complete and utter destruction of the iron. to get your mind and muscles prepared for the impending battle with the weights, you need a pre workout that emboldens you with the fire of 1,000 suns and the energy of a supernova. you need a cutting-edge pre workout that will push you to the utmost extreme and then a little more.you need dust x!dust x is the single most powerful and explosive pre workout ever formulated. each scoop delivers intense, long-lasting energy and sleeve-splitting pumps that will make you never want to leave the gym. hardcore training demands a hardcore pre workout, and for that the only option is dust x! instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/dust-extremehttps://cdn.shopify.com/s/files/1/2544/1734/products/dustX-sourgummybear_600x600_crop_center.png?v=1539139021Blackstone Labs new 431323021349in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 35.99GBP shopify_431323021349_12624136994867Dust x dust x extreme pre-workout150mg of 2-aminoisoheptaneimproved flavoring descriptionheading into the gym you should be focused on one thing and one thing only -- complete and utter destruction of the iron. to get your mind and muscles prepared for the impending battle with the weights, you need a pre workout that emboldens you with the fire of 1,000 suns and the energy of a supernova. you need a cutting-edge pre workout that will push you to the utmost extreme and then a little more.you need dust x!dust x is the single most powerful and explosive pre workout ever formulated. each scoop delivers intense, long-lasting energy and sleeve-splitting pumps that will make you never want to leave the gym. hardcore training demands a hardcore pre workout, and for that the only option is dust x! instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water 30 minutes prior to workout on training days, or first thing in the morning on non-training days. due to extreme potency, new users may wish to asses tolerance with one half (1/2) scoop.https://redsupps.co.uk/products/dust-extremehttps://cdn.shopify.com/s/files/1/2544/1734/products/dustX-sourgummybear_600x600_crop_center.png?v=1539139021Blackstone Labs new 431323021349in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 35.99GBP shopify_737531723827_8790787588147Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1539139043SPARTA NUTRITION new 737531723827in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 59.99GBP shopify_737531723827_8790787620915Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1539139043SPARTA NUTRITION new 737531723827in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 59.99GBP shopify_737531723827_8790787653683Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1539139043SPARTA NUTRITION new 737531723827in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 59.99GBP shopify_737531723827_8790787686451Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1539139043SPARTA NUTRITION new 737531723827in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 59.99GBP shopify_737531723827_8790787719219Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1539139043SPARTA NUTRITION new 737531723827in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 59.99GBP shopify_737531723827_8790787751987Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1539139043SPARTA NUTRITION new 737531723827in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 59.99GBP shopify_737531723827_8790787784755Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1539139043SPARTA NUTRITION new 737531723827in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 59.99GBP shopify_737531723827_8790787817523Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1539139043SPARTA NUTRITION new 737531723827in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 59.99GBP shopify_737531723827_8790787850291Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1539139043SPARTA NUTRITION new 737531723827in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 59.99GBP shopify_737531723827_8790787883059Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1539139043SPARTA NUTRITION new 737531723827in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 59.99GBP shopify_737531723827_8790787915827Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1539139043SPARTA NUTRITION new 737531723827in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 59.99GBP shopify_737531723827_8790787948595Elite energy stack  descriptionwe get it - dieting sucks. you’re hungry, you’re tired, and you’re maybe even a little hangry. but, we all need something to keep us going cause whether we like it or not, life goes on. with the elite energy stack, confidently move forward knowing that you’ll be a fully functional human being for the 16-20 hours you need be.tired before the gym? kraken’s got your back. tired before that 2:00 pm meeting? slam back a scoop of hydrashred and let’s get rolling. with this stack, a lack of ready-to-go energy is a thing of the past. suggested usehydrashred: take one serving first thing in the morning upon waking, and an additional serving later in the day (am / pm dosing)kraken: take one serving (one scoop) prior to working out.https://redsupps.co.uk/products/elite-energy-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/eliteenergystack_1_820x_272d5fb4-aa16-4418-9406-dae4c8f93faa_600x600_crop_center.jpg?v=1539139043SPARTA NUTRITION new 737531723827in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE ENERGY STACK 59.99GBP shopify_675578871859_8238667563059Elite hardcore stack stacks automatically discounted 10% or morewhat's included?abnormalbrutal 4cechosen 1eradicategear supportmetha-quad extremepctv https://redsupps.co.uk/products/elite-hardcore-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elite-dhea_1024x_20683a86-83ef-4dee-954f-996a28dae709_600x600_crop_center.png?v=1539139046Blackstone Labs new 675578871859out of stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsElite HARDCORE Stack 282.99GBP shopify_737540407347_8791060873267Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791060906035Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791060938803Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791060971571Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061004339Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061037107Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061069875Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061102643Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061168179Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061233715Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061299251Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061364787Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061397555Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061463091Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061528627Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061594163Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061659699Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061725235Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061790771Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061856307Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061889075Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791061954611Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791062020147Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_737540407347_8791062085683Elite pre workout stack  descriptionpre-workout dominance redefined with the elite pre-workout stack. never before has there been such a clinically dosed pre-workout combo that focuses on increasing energy and muscle pumps. with kraken, experience what many call the industry’s best neurosensory focused pre-workout supplement that is guaranteed to dial you in for the workout of your life. kraken pump will boost nitric oxide levels to never-before-seen heights, making sure you have skin-splitting muscle pumps. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.https://redsupps.co.uk/products/elite-pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/elitepreworkoutstack_820x_1_600x600_crop_center.jpg?v=1539139048SPARTA NUTRITION new 737540407347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsELITE PRE WORKOUT STACK 59.99GBP shopify_621486800947_7787007803443Entice her - performance for women entice her is the landmark formula to bringing a woman’s sexual experience to a new plateau. if you’re serious about upping the pleasure and intensity, entice her actively works to dramatically increase sensitivity in your areas of interest. simply take 4 capsules 15-20 minutes before engaging in sexual activity, or for a boost to your mood, take 4 capsules upon waking.men looking to enhance their sexual performance should try the male version of this product, entice her.for optimum results, couples should take these products together. prepare for the best night of your lives.https://redsupps.co.uk/products/entice-her-performance-for-womenhttps://cdn.shopify.com/s/files/1/2544/1734/products/image_3a4ce2fc-8a97-486e-b9a4-09de426da2a8_600x600_crop_center.png?v=1539139050Entice new 621486800947in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsSexual Performance Formula 34.99GBP shopify_619178197043_7775131697203Entice him - performance for men entice him is the real deal for men looking to up their game in the bedroom. reach new peaks of sexual performance and intensity with our one-of-a-kind formula. this is accomplished by increasing your own pleasure through increased sensitivity where it matters. entice him will also increase blood flow, which will lead to noticeably increased size. entice him is also a mood-enhancer, perfect for setting the mood to any encounter. simply take 2 tablets in the morning with a meal, daily.for the ladies, if you want to enhance your sexual experience, check out the female version, entice her.for optimum results, couples should take these products together. prepare for the best night of your lives.https://redsupps.co.uk/products/entice-him-performance-for-menhttps://cdn.shopify.com/s/files/1/2544/1734/products/image_a3a63159-10c7-4878-95e9-e1f0a8554701_600x600_crop_center.png?v=1539139055Entice new 619178197043in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsSexual Performance Formula 34.99GBP shopify_369639129125_4714174349349Epicat benefitsexceed muscular limitdoes not require pct descriptionseveral factors impact your ability to grow muscle. most of those you can control (diet, exercise, recovery), but the biggest factor governing your ability to build massive muscles (your genetics) you have no control over...until now!epicat is a revolutionary all-natural muscle building supplement that flips the genetic switch, enabling you to become the physical freak that nature never intended. epicat isn’t a steroid, prohormone, or some other research chemical. it utilizes extracts isolated from dark chocolate and green tea to boost your anabolic potential and transform it a tower of strength and power! ingredientsgreen tea (700mg) enhances thermogenesis, metabolism, and fat oxidation resulting in greater fat burning during exercise and at rest. green tea is packed with powerful antioxidants that combat oxidative stress and promote overall health and recovery from exercise.epicatechin (300mg) significantly aids muscle growth by inhibiting myostatin, a protein present in your muscles cells that limits growth and differentiation. research shows that epicatechin stimulates release of follistatin, another protein that blocks the actions of myostatin, leading to increased exercise capacity, strength, and muscle growth. directionsas a dietary supplement, take one (1) caposule two (2) times daily with food. do not exceed two (2) capsules daily.https://redsupps.co.uk/products/blackstone-labs-epicat-60-capsules-dry-hard-gainshttps://cdn.shopify.com/s/files/1/2544/1734/products/epicat_600x600_crop_center.png?v=1539139071Blackstone Labs new 369639129125in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMyostatin Blocker 39.00GBP shopify_369643782181_4714190635045Eradicate estrogen blocker benefitsreduces estrogen levelsreduces fat storage descriptionalways feel bloated or puffy? having trouble getting those “stubborn pounds”? moody and lethargic?these are the hallmark signs of estrogen dominance in the body. with rampant estrogen production, you’ll build less muscle and store more fat -- something no man wants.it’s time to take back your manhood, and obliterate estrogen with eradicate.eradicate is a powerful suicide aromatase inhibitor (ai) that estrogen levels, promotes optimal testosterone production, and enhances sex drive. eradicate is perfect for natural and non-natural athletes looking to take control of their hormones and maximize muscle growth. ingredientsn-acetyl l-cysteine (250mg) increases production of glutathione, a powerful antioxidant that protects the liver and helps detoxify the body.safed musli (250mg) increases spermatogenesis (sperm production) and improves erectile strength. safed musli also enhances hepatic glutathione, for increased antioxidant activity, and reduces lipid peroxidation.arimistane (25mg) is a powerful aromatase inhibitor (ai) that decreases circulating levels of estrogen and cortisol in the body. arimistane acts as a suicidal ai, which prevents the conversion of testosterone to estrogen and maximizes natural testosterone production. directionsas a dietary supplement, take one (1) capsule two to three (2-3) times daily with food. due to the extreme potency, do not use for nor longer than 8 weeks without a 4 week off period. do not exceep four (4) capsules in a 24 hour period.https://redsupps.co.uk/products/blackstone-labs-eradicate-90cap-great-pct-and-on-cycle-eliminate-estro-cut-waterhttps://cdn.shopify.com/s/files/1/2544/1734/products/eradicate_d6d825a6-2d45-41b2-9e19-3ebebc0dc202_600x600_crop_center.png?v=1539139097Blackstone Labs new 369643782181out of stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsEstrogen Blocker 34.99GBP shopify_369636573221_4714168418341Euphoria rx enhances moodincreases sexual stimulation descriptionneed to unwind after a long, stressful day at the office? the thought of having a drink or two is intriguing, but you don’t want the inevitable hangover and sluggishness that inevitably results from a night of drinking.there must be something that helps take the edge, but doesn’t come with a laundry list of drawbacks, and blackstone labs created it in euphoria.euphoria is an all-natural, hangover free relaxation supplement that helps you unwind no matter how tightly you’ve been wound. euphoria is ideal of a chill night at home or a night out partying with friends. it’s also ideal for the more introverted folks who have a hard time cutting loose in social settings. one serving of euphoria and you’ll swear this stuff can’t be legal! it’s just that good! ingredientsbeta-phenethylamine increases levels of several “happy hormones” in the body, including dopamine and serotonin. phenylethylamine (pea) can cross the blood-brain barrier and impart a quick and powerful boost in mood and wellbeing.cdp-choline enhances production of acetylcholine (“the learning neurotransmitter”). with greater acetylcholine levels in the body, you’ll feel more focused and “with it” even after the most brain-draining day at the office..5-htp is generated tryptophan and converted to serotonin. since serotonin helps regulate behavior and mood, 5-htp may positively affect mood, appetite, and sleep.cymbidium goeringii helps the body adapt to stressful challenges such as those during intense exercise or high pressure social situations. as an adaptogen, this herb reduces mental and physical fatigue brought on by stress and promotes a sense of calm.l-theanine is a relaxing amino acid found prevalently in tea leaves. theanine is renowned for its ability to reduce stress and induce relaxation without sedation.n-acetyl l-tyrosine reduces stress by enhancing production of dopamine, epinephrine, norepinephrine. these three neurotransmitters also improve focus and alertness. directionsas a dietary supplement, take four to six (4-6) capsules on an empty stomach to assess tolerance. do not use more than one (1) bottle per day.a https://redsupps.co.uk/products/blackstone-labs-euphoria-rx-16-capsuleshttps://cdn.shopify.com/s/files/1/2544/1734/products/euphoria_061a6f05-d234-4470-ad72-04b6c8815956_600x600_crop_center.png?v=1539139180Blackstone Labs new 369636573221out of stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsRecreational Supplement 17.00GBP shopify_660703674419_8019687047219Evaporate evaporate immediate water-loss agentcompetition strength diuretic descriptionevaporate is a competition-strength diuretic designed to immediately pull a significant amount of the water out of the body. this product is not intended for prolong use and contains ten servings per bottle. ingredientsvitamin b6 (100mg) reduces built up bodily fluids due to its water retention properties. magnesium (50mg) a vital mineral that helps reduce water retention in the body. additionally, magnesium also has been shown to help provide muscular strength and can alleviate high blood pressure. taraxcum officinate extract (2000mg) acts an anti-inflammatory and reduces muscle spasms. commonly used a natural diuretic, it also has been used in herbal medicines as a mild laxative and helps improve digestion. uva ursi extract (1000mg) acts as a diuretic and contains ursolic acid, powerful astringents, and helps promote the growth of healthy new cells. it is also used to help reduce inflamation, increase urine flow, and reduce bloating and water retention. tropaeolum majus (500mg) helps to directly increase urinary flow and is also a good source of vitamin c green tea extract (300mg) enhances thermogenesis, metabolism, and fat oxidiation resulting in greater fat burning during exercise and while at rest. horsetail (250mg) increases urine production and has gained popularty as a treatment for kidney stones and uti's. taurine (150mg) helps alleviate high blood pressure, aids digestion, and helps reduce water retention and bloating. instructionsas a dietary supplement, take three (3) capsules after morning meal and three (3) capsules after mid-day meal, along with sixteen (16) ounces of water. drink at least six (6) to eight (8) 8 ounce glasses of water daily. do not exceed reccomded dose.https://redsupps.co.uk/products/evaporate-60capshttps://cdn.shopify.com/s/files/1/2544/1734/products/evaporate_600x600_crop_center.png?v=1539139188Blackstone Labs new 660703674419in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCompetition-Strength Diuretic 24.99GBP shopify_719659565107_8548550049843Eve 180 softgels descriptionwith evening primrose, cranberry, green tea, horsetail silica & coq10gentler and easier to swallow & absorba dietary supplementvitaminsfamily owned since 1968gmp quality assuredthese multi-vitamin softgels are easier to swallow, and are formulated for better gi tolerability. suggested usetake 3 softgels daily with food. other ingredientssoftgel capsule (gelatin, glycerin, water, carob), flax seed oil, soy lecithin and beeswax.not manufactured with wheat, gluten, milk, egg, fish or shellfish ingredients. produced in a gmp facility that processes other ingredients containing these allergens.store in a cool, dry place after opening.https://redsupps.co.uk/products/eve-180-softgelshttps://cdn.shopify.com/s/files/1/2544/1734/products/eve_600x600_crop_center.jpg?v=1539139201NOW FOODS new 719659565107in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMultivitamin 29.99GBP shopify_473665044517_5237623980069Fast food meal replacement fast food meal replacementvegetarian-friendly10 grams of plant protein descriptionask anyone who’s ever put on a lot of muscle mass, and they’ll all tell you the same thing. training is the easy part, eating all those calories is hard. whether you struggle with appetite finding time to cook (and then eat), the end result is the same -- the number on the scale doesn’t budge.blackstone labs has yet again created the ultimate supplement to help you get huge in a hurry with fast food.fast food is a meal replacement / mass gainer supplement made from 100% real food sources. there are no cheap carb sources like maltodextrin or dextrose here. each serving of fast food delivers high quality protein, carbohydrates, and fats from ingredients like organic pea protein isolate, organic brown rice protein, sweet potato, and wild yam, among others. ingredientspea protein isolate is one of the few plant-based proteins that offers a “complete” protein, thereby delivering all nine essential amino acids required for protein synthesis.brown rice protein is a plant protein that is hypoallergenic, dairy-free, and easy to digest. research notes that brown rice protein can support kidney and heart health and improve liver function.sweet potato contains high amounts of beta-carotene (vitamin a), as well as numerous other vitamins and minerals including manganese, copper, and pantothenic acid.wild yam is another starchy root vegetable, similar to sweet potato, that’s rich in complex carbohydrates, fiber, and micronutrients. oat flour provides a source of slow-digesting carbohydrates that give sustained energy. research notes that oats are rich in beta-glucan which can reduce total serum cholesterol and ldl cholesterol. mct powder contains powdered medium-chain triglycerides which provide a source of healthy fats that can be immediately used as a source of energy in the body.coconut water is rich in valuable electrolytes, such as potassium, which restore hydration and electrolyte levels following intense exercise. d-ribose combines with adenine in the body to enhance atp regeneration following exhaustive exercise, enabling you to recover faster and perform longer. instructionsas a deitary supplement, mix one (1) scoop with 6-8 oz. of water. mix thoroughly.https://redsupps.co.uk/products/fast-food-meal-replacementhttps://cdn.shopify.com/s/files/1/2544/1734/products/fastfood-candiedYams_600x600_crop_center.png?v=1539139206Blackstone Labs new 473665044517in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMeal Replacement 45.00GBP shopify_675567075379_8238563131443Fat burner stack stacks automatically discounted 10% or morewhat's included?1 trojan horse (choose flavour)1 paraburnhttps://redsupps.co.uk/products/fat-burner-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/female-male-weightloss_1024x_c93b9f40-936e-4179-8e7c-549e935be431_600x600_crop_center.png?v=1539139215Blackstone Labs new 675567075379in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsFat Burner Stack 52.99GBP shopify_675567075379_8238563164211Fat burner stack stacks automatically discounted 10% or morewhat's included?1 trojan horse (choose flavour)1 paraburnhttps://redsupps.co.uk/products/fat-burner-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/female-male-weightloss_1024x_c93b9f40-936e-4179-8e7c-549e935be431_600x600_crop_center.png?v=1539139215Blackstone Labs new 675567075379in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsFat Burner Stack 52.99GBP shopify_369632870437_4714159210533Formula 19 formula-19leucine for instant anabolic effectelectrolytes for hydration and recovery descriptionformula 19 is the direct result of 19 years spent developing and perfecting the ultimate post-workout supplement. this concoction of 5 key ingredients provides the essential nutrients your body needs to recover faster, reduce soreness, and sustain your muscle pumps for hours after you’ve set down the weights.formula 19 isn’t like any other recovery supplement on the market. it uses a synergistic blend of ingredients to rapidly replenish glycogen stores, activate protein synthesis, and halt muscle breakdown. formula 19 isn’t just another post workout supplement, it’s the post-workout supplement. ingredientsr3 carbohydrate blend (25g) contains a scientific blend of three rapidly digesting carbohydrates but without the unwanted insulin spike. the r3 carbohydrate formula is quickly absorbed, meaning no “heavy feeling” during training, making it the ultimate pre and post workout fuel.l-glutamine (4.5g) is an amino acid lost in substantial quantities during intense exercise. glutamine is essential to recovery following strenuous physical activity and immune system function. it also helps conserve lean muscle mass by preventing catabolism.l-leucine (2.5g) is one of the three branched chain amino acids (bcaas) and primary activator of mtor. leucine induces muscle protein synthesis, which supports muscle growth and prevents catabolism.magnesium glycyl glutamine (500mg) is stabilized glutamine in the world, protected by an exclusive patent. this form of glutamine offers enhanced bioavailability and ensures safe passage through the tortuous gi system. alpha lipoic acid (100mg) improves the body’s ability to absorb and convert sugar to energy, making it ideal to take with carbohydrates. alpha lipoic acid (ala) acts as an “insulin-mimetic) and shuttle the carbohydrates contained in formula 19, along with all the other nutrients here, directly into your muscles for maximum effectiveness. instructionsfor men: as a dietary supplement, mix two (2) scoops in 8-10 oz. of water and take post-workout on training days.for women: as a dietary supplement, mix two (1) scoops in 8-10 oz. of water and take post-workout on training days. https://redsupps.co.uk/products/blackstone-labs-formula-19https://cdn.shopify.com/s/files/1/2544/1734/products/formula19-fruitpunch_600x600_crop_center.png?v=1539139226Blackstone Labs new 369632870437in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPost Workout Formula 29.99GBP shopify_369632870437_4714159243301Formula 19 formula-19leucine for instant anabolic effectelectrolytes for hydration and recovery descriptionformula 19 is the direct result of 19 years spent developing and perfecting the ultimate post-workout supplement. this concoction of 5 key ingredients provides the essential nutrients your body needs to recover faster, reduce soreness, and sustain your muscle pumps for hours after you’ve set down the weights.formula 19 isn’t like any other recovery supplement on the market. it uses a synergistic blend of ingredients to rapidly replenish glycogen stores, activate protein synthesis, and halt muscle breakdown. formula 19 isn’t just another post workout supplement, it’s the post-workout supplement. ingredientsr3 carbohydrate blend (25g) contains a scientific blend of three rapidly digesting carbohydrates but without the unwanted insulin spike. the r3 carbohydrate formula is quickly absorbed, meaning no “heavy feeling” during training, making it the ultimate pre and post workout fuel.l-glutamine (4.5g) is an amino acid lost in substantial quantities during intense exercise. glutamine is essential to recovery following strenuous physical activity and immune system function. it also helps conserve lean muscle mass by preventing catabolism.l-leucine (2.5g) is one of the three branched chain amino acids (bcaas) and primary activator of mtor. leucine induces muscle protein synthesis, which supports muscle growth and prevents catabolism.magnesium glycyl glutamine (500mg) is stabilized glutamine in the world, protected by an exclusive patent. this form of glutamine offers enhanced bioavailability and ensures safe passage through the tortuous gi system. alpha lipoic acid (100mg) improves the body’s ability to absorb and convert sugar to energy, making it ideal to take with carbohydrates. alpha lipoic acid (ala) acts as an “insulin-mimetic) and shuttle the carbohydrates contained in formula 19, along with all the other nutrients here, directly into your muscles for maximum effectiveness. instructionsfor men: as a dietary supplement, mix two (2) scoops in 8-10 oz. of water and take post-workout on training days.for women: as a dietary supplement, mix two (1) scoops in 8-10 oz. of water and take post-workout on training days. https://redsupps.co.uk/products/blackstone-labs-formula-19https://cdn.shopify.com/s/files/1/2544/1734/products/formula19-fruitpunch_600x600_crop_center.png?v=1539139226Blackstone Labs new 369632870437in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPost Workout Formula 29.99GBP shopify_369632870437_4714159276069Formula 19 formula-19leucine for instant anabolic effectelectrolytes for hydration and recovery descriptionformula 19 is the direct result of 19 years spent developing and perfecting the ultimate post-workout supplement. this concoction of 5 key ingredients provides the essential nutrients your body needs to recover faster, reduce soreness, and sustain your muscle pumps for hours after you’ve set down the weights.formula 19 isn’t like any other recovery supplement on the market. it uses a synergistic blend of ingredients to rapidly replenish glycogen stores, activate protein synthesis, and halt muscle breakdown. formula 19 isn’t just another post workout supplement, it’s the post-workout supplement. ingredientsr3 carbohydrate blend (25g) contains a scientific blend of three rapidly digesting carbohydrates but without the unwanted insulin spike. the r3 carbohydrate formula is quickly absorbed, meaning no “heavy feeling” during training, making it the ultimate pre and post workout fuel.l-glutamine (4.5g) is an amino acid lost in substantial quantities during intense exercise. glutamine is essential to recovery following strenuous physical activity and immune system function. it also helps conserve lean muscle mass by preventing catabolism.l-leucine (2.5g) is one of the three branched chain amino acids (bcaas) and primary activator of mtor. leucine induces muscle protein synthesis, which supports muscle growth and prevents catabolism.magnesium glycyl glutamine (500mg) is stabilized glutamine in the world, protected by an exclusive patent. this form of glutamine offers enhanced bioavailability and ensures safe passage through the tortuous gi system. alpha lipoic acid (100mg) improves the body’s ability to absorb and convert sugar to energy, making it ideal to take with carbohydrates. alpha lipoic acid (ala) acts as an “insulin-mimetic) and shuttle the carbohydrates contained in formula 19, along with all the other nutrients here, directly into your muscles for maximum effectiveness. instructionsfor men: as a dietary supplement, mix two (2) scoops in 8-10 oz. of water and take post-workout on training days.for women: as a dietary supplement, mix two (1) scoops in 8-10 oz. of water and take post-workout on training days. https://redsupps.co.uk/products/blackstone-labs-formula-19https://cdn.shopify.com/s/files/1/2544/1734/products/formula19-fruitpunch_600x600_crop_center.png?v=1539139226Blackstone Labs new 369632870437in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPost Workout Formula 29.99GBP shopify_1458898239539_13090576629811Free range liquid egg whites Descriptionwhen it comes to high quality protein there are few more pure or beneficial a source than the humble egg. a solid favourite, it's reliable, trusted and proven, however, dr zak's has put its own twist on this little protein gem.gone are the days of having to separate the egg yolk from the white, creating mess and hassle with the introduction of free range liquid egg whites in a convenient 1kg bottle. and what's even more remarkable is that you do not need to store them in the fridge until opened due to a patent protected pasteurisation process. how cool is that. just think of all that extra space you will free up from your fridge.as if that is not enough, the egg whites contain absolutely no preservatives, just 100% pure liquid egg white and nothing else.so whether you are creating a super healthy omelette, a mega protein shake, or just adding them into your whiskey sour cocktail for some down time, dr zak's liquid egg whites are the perfect solution. ingredients100% pasteurised liquid egg whitesimportant informationstore in a cool dry place. please see bottle cap for best before date. once opened, refrigerate immediately and consume within 48 hours. please ensure cap is closed tightly before storing to ensure freshness.https://redsupps.co.uk/products/free-range-liquid-egg-whiteshttps://cdn.shopify.com/s/files/1/2544/1734/products/Dr-Zaks-Egg-Whites_600x600_crop_center.jpg?v=1539139241Dr Zak's new 1458898239539in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLiquid Egg Whites 4.99GBP shopify_1458898239539_13090576662579Free range liquid egg whites Descriptionwhen it comes to high quality protein there are few more pure or beneficial a source than the humble egg. a solid favourite, it's reliable, trusted and proven, however, dr zak's has put its own twist on this little protein gem.gone are the days of having to separate the egg yolk from the white, creating mess and hassle with the introduction of free range liquid egg whites in a convenient 1kg bottle. and what's even more remarkable is that you do not need to store them in the fridge until opened due to a patent protected pasteurisation process. how cool is that. just think of all that extra space you will free up from your fridge.as if that is not enough, the egg whites contain absolutely no preservatives, just 100% pure liquid egg white and nothing else.so whether you are creating a super healthy omelette, a mega protein shake, or just adding them into your whiskey sour cocktail for some down time, dr zak's liquid egg whites are the perfect solution. ingredients100% pasteurised liquid egg whitesimportant informationstore in a cool dry place. please see bottle cap for best before date. once opened, refrigerate immediately and consume within 48 hours. please ensure cap is closed tightly before storing to ensure freshness.https://redsupps.co.uk/products/free-range-liquid-egg-whiteshttps://cdn.shopify.com/s/files/1/2544/1734/products/Dr-Zaks-Egg-Whites_600x600_crop_center.jpg?v=1539139241Dr Zak's new 1458898239539in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLiquid Egg Whites 4.99GBP shopify_735351930931_8753129914419Gains stack stacks automatically discounted 10% or morewhat's included?maniacontraa simple yet highly effective stack for men seeking lean muscle, strength and overall performance gains while activating your metabolism. get your body composition on the right track and increase your vascularity, get solid muscles and elevate your muscular / sexual stamina. note: use stack 4-8 weeks. no 'on cycle support' is required.https://redsupps.co.uk/products/gains-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/CONTRA-AND-MANIA-STACK_1024x_84084182-319b-40d5-851d-64fb37bf1cbe_600x600_crop_center.jpg?v=1539139245MYOBLOX new 735351930931in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsGAINS STACK 79.00GBP shopify_369641521189_4714183950373Gear support gear support protects your organstake alongside intense products descriptionrunning a cycle of potent muscle-building compounds can bring some of the greatest gains you’ve ever experienced. but with those big gains comes some big risks that if you’re not prepared for, can leave you broken, beaten, and bleeding.don’t fret as blackstone labs has you covered with gear support.gear support is a robust and comprehensive cycle support supplement to be used anytime you’re running an aggressive supplement cycle. gear support provides the essential nutrients your vital organs need to protect, detoxify, and purify them while on cycle. ingredientsn-acetyl l-cysteine (400mg) is a powerful antioxidant that eliminates free radicals and neutralizes toxins. as a precursor to glutathione (another powerful antioxidant), n-acetyl l-cysteine promotes liver health and supports immune system functionhawthorne berry (300mg) dilates the coronary arteries, improving blood and oxygen supply to the heart. hawthorne berry also strengthens the heart's pumping ability, aiding cardiovascular function and efficiency.red clover (100mg) supports cardiovascular healthy by improving blood circulation and increasing hdl (“good”) cholesterol. red clover is believed to “purify” the blood since it exerts a diuretic-like effect in the body.celery extract 4:1 (75mg) combats high blood pressure (hypertension) and offers some measure of liver protection due to its high phthalide content. phthalides are volatile compounds present in celery responsible for the extract's efficacy.grape seed extract (75mg) protects cells from free radical damage due to its high antioxidant and polyphenol content. research also demonstrates that grape seed extract supports cardiovascular health by improving circulation. instructionsas a dietary supplement, take one (1) capsule one to two (1-2) times daily with food. do not exceed two (2) capsules daily.https://redsupps.co.uk/products/blackstone-labs-gear-support-90cap-complete-on-and-post-cycle-ph-saa-supporthttps://cdn.shopify.com/s/files/1/2544/1734/products/gearsupport_600x600_crop_center.png?v=1539139248Blackstone Labs new 369641521189in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsCycle Support 27.00GBP shopify_369643847717_4714190700581Glycolog glycologmaximizes insulin utilizationimproves glucose metabolism descriptioncarbs have gotten a pretty bad rap in recent years. they’ve become outcasts, shunned by everyone from celebrities to soccer moms and even high-level athletes, who need them more than anyone else!carbs have been painted as disgusting little vermin that do nothing but make you fat, lazy, and disgusting. the reason is that eating carbs increase insulin, the body’s storage hormone. insulin can either shuttle carbs into fat or muscle depending on your genetics, and for most individuals, they have poor genetics, which means eating carbs inevitably leads to increased fat.that’s where glycolog comes in. it hacks your genetic code to make insulin work for you, not against you. glycolog acts as a nutrient partitioner, directs those carbs you eat into your muscles and not your adipose tissue.using glycolog means carbs are back on the menu again, and they’re bringing some serious lean gains with them! ingredientsgymnema sylvestre (1g) enhances insulin function to reduce blood sugar. a comprehensive review of the scientific literature on gymnema sylvestre notes it also reduces plasma glucose, leptin levels, body weight, and even body mass index (bmi).[bitter melon (500mg) increases glucose uptake and utilization by skeletal muscles as well as reduces formation of glycogen in the liver. additional research on bitter melon notes in also suppresses inflammation in adipose tissue (fat).super berberine (300mg) lowers blood glucose levels and encourages glucose absorption by muscle cells. glycolog includes the trademarked super berberine for its improved bioavailability over standard berberine supplements.cinnamon bark (250mg) increases insulin activity while simultaneously acting as an insulin mimetic to facilitate glucose transport into skeletal muscle tissue. cinnamon bark reduces blood sugar, cuts body fat, and increases lean mass.sodium r-lipoate (150mg) is a highly bioavailable form of alpha lipoic acid (ala). ala is essential to carbohydrate metabolism and also acts as a powerful antioxidant in the body. it helps lower blood sugar, reduce appetite, and increase energy expenditure.bioperine (5mg) can enhance the effectiveness of the blood sugar-lowering compounds in glycolog by increasing the time they remain active in the bloodstream.chromium (300mcg) is an essential mineral that helps regulate blood glucose. chromium is critical to insulin metabolism and therefore a vital component to nutrient uptake in the body. directionsas a dietary supplement, take three (3) capsules with a high-carb meal two (2) times per day. do not exceed six (6) capsules daily.https://redsupps.co.uk/products/blackstone-labs-glycolog-180caps-extreme-slin-mimetic-get-huge-quickhttps://cdn.shopify.com/s/files/1/2544/1734/products/glycolog_600x600_crop_center.png?v=1539139277Blackstone Labs new 369643847717in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsNutrient Partitioning Agent 39.00GBP shopify_369641488421_4714183917605Growth benefitspost workout recoveryburn calories while sleeping descriptionmuscle growth -- it’s whatever athlete desires from a life spent lifting heavy. one of the biggest contributors to muscle growth is a little hormone called hgh, human growth hormone. this hormone stimulates growth, cell reproduction, and cell regeneration in humans. unfortunately, using exogenous hgh is highly illegal and can come with serious side effects.however, there is an all-natural way to stimulate greater hgh release in the body and blackstone labs has come up with the ultimate hgh-boosting formula in growth.growth is a superior all-natural way to boost growth hormone release and get a better night’s sleep for superhuman muscle building and recovery. instructionsas a dietary supplement, take three (3) capsules 30 minutes before bed. do not exceed three (3) capsules daily.https://redsupps.co.uk/products/blackstone-labs-growth-90caps-helps-to-recover-get-leaner-grow-more-stay-younghttps://cdn.shopify.com/s/files/1/2544/1734/products/growth_600x600_crop_center.png?v=1539139290Blackstone Labs new 369641488421in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsGH Booster 29.99GBP shopify_675577364531_8238649671731Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1539139300Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649704499Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1539139300Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649737267Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1539139300Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649770035Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1539139300Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649802803Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1539139300Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649835571Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1539139300Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649868339Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1539139300Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649901107Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1539139300Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649933875Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1539139300Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649966643Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1539139300Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238649999411Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1539139300Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238650032179Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1539139300Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238650064947Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1539139300Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238650097715Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1539139300Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238650130483Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1539139300Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_675577364531_8238650163251Hardcore 2-pack stack stacks automatically discounted 10% or morewhat's included?any 2 dhea prohormone of your choicehttps://redsupps.co.uk/products/hardcore-2-pack-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/dhea_1024x_2d541328-0a8f-4a2c-97c8-5c045a41f0d2_600x600_crop_center.png?v=1539139300Blackstone Labs new 675577364531in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 89.99GBP shopify_551826948147_7270253789235Hormone-free stack stacks automatically discounted 10% or morewhat's included?anogeninepicatgrowthhttps://redsupps.co.uk/products/natural-mass-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/natural-mass_480x_b93a38cd-0128-468f-a33a-5b33b05d3029_600x600_crop_center.png?v=1539139303Blackstone Labs new 551826948147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsNatural Mass Stack 97.00GBP shopify_691177619507_8412863561779Hormone-free stack plus stacks automatically discounted 10% or morewhat's included?anogeninepicatgrowthrecomp rxhttps://redsupps.co.uk/products/hormone-free-stack-plushttps://cdn.shopify.com/s/files/1/2544/1734/products/natural-mass-plus_1024x_77eebb30-1534-45eb-a916-6271f8a163ff_600x600_crop_center.png?v=1539139306Blackstone Labs new 691177619507in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsHormone-Free Stack Plus 132.99GBP shopify_733996941363_8712674672691Hydra8 bcaa  descriptionan extremely popular category of sports nutrition products, amino acids have become a far-cry of their main purpose of supplementation: muscle growth and recovery.supplement companies now focus solely on flavouring and cut down on the amount of amino acids, mainly leucine, in order to offer the best flavouring, quickly. rather than spend months in r&d testing and crafting a flavour profile that doesn’t have to skimp on quality, many just cut down on dosages and use run-of-the-mill flavors, such as fruit punch, to quickly launch their amino acid powder.at sparta nutrition, we’ve carefully crafted hydra8 bcaa to be the leading choice when it comes to intra or post-workout nutrition for those looking to maximise their muscle recovery from intense, gruelling training sessions. perfect for endurance athletes, bodybuilders, and even crossfit athletes, hydra8 bcaa is an expertly dosed bcaa powder supplement combined with a unique energy complex designed to give you a much needed pick-me-up while you train and fatigue.  not only does hydra8 bcaa offer bcaa’s & an energy complex, it also contains l-glutamine, a very well known conditionally essential amino acid that offers incredible synergy with bcaa’s to even further maximise your recovery.https://redsupps.co.uk/products/hydra8-bcaahttps://cdn.shopify.com/s/files/1/2544/1734/products/hydra_green_apple_1_1_600x600_crop_center.png?v=1539633678SPARTA NUTRITION new 733996941363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids & Energy 27.50GBP shopify_733996941363_8712674705459Hydra8 bcaa  descriptionan extremely popular category of sports nutrition products, amino acids have become a far-cry of their main purpose of supplementation: muscle growth and recovery.supplement companies now focus solely on flavouring and cut down on the amount of amino acids, mainly leucine, in order to offer the best flavouring, quickly. rather than spend months in r&d testing and crafting a flavour profile that doesn’t have to skimp on quality, many just cut down on dosages and use run-of-the-mill flavors, such as fruit punch, to quickly launch their amino acid powder.at sparta nutrition, we’ve carefully crafted hydra8 bcaa to be the leading choice when it comes to intra or post-workout nutrition for those looking to maximise their muscle recovery from intense, gruelling training sessions. perfect for endurance athletes, bodybuilders, and even crossfit athletes, hydra8 bcaa is an expertly dosed bcaa powder supplement combined with a unique energy complex designed to give you a much needed pick-me-up while you train and fatigue.  not only does hydra8 bcaa offer bcaa’s & an energy complex, it also contains l-glutamine, a very well known conditionally essential amino acid that offers incredible synergy with bcaa’s to even further maximise your recovery.https://redsupps.co.uk/products/hydra8-bcaahttps://cdn.shopify.com/s/files/1/2544/1734/products/hydra_green_apple_1_1_600x600_crop_center.png?v=1539633678SPARTA NUTRITION new 733996941363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids & Energy 27.50GBP shopify_733996941363_12968859861043Hydra8 bcaa  descriptionan extremely popular category of sports nutrition products, amino acids have become a far-cry of their main purpose of supplementation: muscle growth and recovery.supplement companies now focus solely on flavouring and cut down on the amount of amino acids, mainly leucine, in order to offer the best flavouring, quickly. rather than spend months in r&d testing and crafting a flavour profile that doesn’t have to skimp on quality, many just cut down on dosages and use run-of-the-mill flavors, such as fruit punch, to quickly launch their amino acid powder.at sparta nutrition, we’ve carefully crafted hydra8 bcaa to be the leading choice when it comes to intra or post-workout nutrition for those looking to maximise their muscle recovery from intense, gruelling training sessions. perfect for endurance athletes, bodybuilders, and even crossfit athletes, hydra8 bcaa is an expertly dosed bcaa powder supplement combined with a unique energy complex designed to give you a much needed pick-me-up while you train and fatigue.  not only does hydra8 bcaa offer bcaa’s & an energy complex, it also contains l-glutamine, a very well known conditionally essential amino acid that offers incredible synergy with bcaa’s to even further maximise your recovery.https://redsupps.co.uk/products/hydra8-bcaahttps://cdn.shopify.com/s/files/1/2544/1734/products/hydra_green_apple_1_1_600x600_crop_center.png?v=1539633678SPARTA NUTRITION new 733996941363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids & Energy 27.50GBP shopify_733996941363_12968984182835Hydra8 bcaa  descriptionan extremely popular category of sports nutrition products, amino acids have become a far-cry of their main purpose of supplementation: muscle growth and recovery.supplement companies now focus solely on flavouring and cut down on the amount of amino acids, mainly leucine, in order to offer the best flavouring, quickly. rather than spend months in r&d testing and crafting a flavour profile that doesn’t have to skimp on quality, many just cut down on dosages and use run-of-the-mill flavors, such as fruit punch, to quickly launch their amino acid powder.at sparta nutrition, we’ve carefully crafted hydra8 bcaa to be the leading choice when it comes to intra or post-workout nutrition for those looking to maximise their muscle recovery from intense, gruelling training sessions. perfect for endurance athletes, bodybuilders, and even crossfit athletes, hydra8 bcaa is an expertly dosed bcaa powder supplement combined with a unique energy complex designed to give you a much needed pick-me-up while you train and fatigue.  not only does hydra8 bcaa offer bcaa’s & an energy complex, it also contains l-glutamine, a very well known conditionally essential amino acid that offers incredible synergy with bcaa’s to even further maximise your recovery.https://redsupps.co.uk/products/hydra8-bcaahttps://cdn.shopify.com/s/files/1/2544/1734/products/hydra_green_apple_1_1_600x600_crop_center.png?v=1539633678SPARTA NUTRITION new 733996941363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids & Energy 27.50GBP shopify_733877665843_8707321462835Hydrashred  descriptionlosing weight, getting shredded, and the pursuit of dropping body fat can be amongst the most arduous of tasks out there. if you've ever done cardio, you know that each and every minute is feels like eternity. it's time to capitalize and utilize the most advanced premium ultra strength lipolytic fat burner available: hydrashred.featuring premium dosages of garcinia cambogia extract, 6 different types of caffeine, ultra-powerful stimulants, grains of paradise, acetyl-l-carnitine, banaba leaf, l-carnitine-l-tartrate, and more, it just doesn't get better. burn fat, shape your physique, reduce your appetite, and increase energy now.hydrashred tablets feature dual release technology, which simply means that each and every single tablet has two parts: instant release and 6-hour time release. this way you're effectively getting the actives released throughout your body throughout the day. [this differs from the hydrashred powder which hits immediately].https://redsupps.co.uk/products/hydra-shredhttps://cdn.shopify.com/s/files/1/2544/1734/products/hydra_shred_tabs_1_600x600_crop_center.png?v=1539139373SPARTA NUTRITION new 733877665843in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsFat Burner 32.99GBP shopify_733883760691_8707544383539Hydrashred powder  descriptionlosing weight, getting shredded, and the endless pursuit of dropping stubborn body fat can be amongst the most arduous of tasks out there.if you've ever done cardio, you know that each and every minute feels like an eternity. it's time to capitalize and utilize the most advanced lipolytic thermogenic fat burner available designed to torch fat deposits off your midsection and love handles: hydrashred.featuring scientifically validated dosages of key weight loss ingredients such as garcinia cambogia & green coffee bean extract, grains of paradise, banaba leaf, l-carnitine-l-tartrate, and a unique never-before-seen neurosensory blend featuring 6 different types of caffeine, it just doesn't get better. burn fat, tone your physique, reduce your appetite, and increase your energy levels now.whether it's using hydrashred to burn body fat or even use it as a pre-workout powdered thermogenic, it has a place in everyone's supplement routine. since hydrashred conveniently comes in a ready-to-mix delicious powder, you can mix it in ice-cold water and sip on it all day.https://redsupps.co.uk/products/hydrashred-lypolitic-fat-burnerhttps://cdn.shopify.com/s/files/1/2544/1734/products/coldbrewcoffee_2048x2048_64d03f03-06e3-4a7e-88d6-f37b8cae1cbc_600x600_crop_center.jpg?v=1539139390SPARTA NUTRITION new 733883760691in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsFat Burner 32.99GBP shopify_520100380723_6993212538931Hype benefitsskin ripping pumpsincreased bloodflow descriptionmen and women alike train for countless hours each week all in pursuit of the ultimate pump. nothing is more elusive, or rewarding, than having a massive pump while you train. unfortunately, within 30 minutes of leaving the gym, your pump is gone, and you’re back to looking like you’re average, scrawny self. wouldn’t it be great to have a pump that lasted for hours after you finished lifting? blackstone labs has developed the ultimate supplement to keep your muscles swollen all day long in hype.hype is a 100% stimulant free nitric oxide boosting supplement providing maximum muscle pumps all day, every day. it’s ideal to stack with any stim-based pre workout or used as a standalone option for those sensitive to caffeine or training at night. stop getting frustrated with a short-lived pump, and start looking, and feeling, better with hype. instructionsas a dietary supplement, take one (1) scoop with 6-8 oz. of water once per day, 20 minutes before a workout. do not exceed two (2) scoops daily.https://redsupps.co.uk/products/hypehttps://cdn.shopify.com/s/files/1/2544/1734/products/hype-orange_600x600_crop_center.png?v=1539139432Blackstone Labs new 520100380723in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 29.00GBP shopify_520100380723_6993213325363Hype benefitsskin ripping pumpsincreased bloodflow descriptionmen and women alike train for countless hours each week all in pursuit of the ultimate pump. nothing is more elusive, or rewarding, than having a massive pump while you train. unfortunately, within 30 minutes of leaving the gym, your pump is gone, and you’re back to looking like you’re average, scrawny self. wouldn’t it be great to have a pump that lasted for hours after you finished lifting? blackstone labs has developed the ultimate supplement to keep your muscles swollen all day long in hype.hype is a 100% stimulant free nitric oxide boosting supplement providing maximum muscle pumps all day, every day. it’s ideal to stack with any stim-based pre workout or used as a standalone option for those sensitive to caffeine or training at night. stop getting frustrated with a short-lived pump, and start looking, and feeling, better with hype. instructionsas a dietary supplement, take one (1) scoop with 6-8 oz. of water once per day, 20 minutes before a workout. do not exceed two (2) scoops daily.https://redsupps.co.uk/products/hypehttps://cdn.shopify.com/s/files/1/2544/1734/products/hype-orange_600x600_crop_center.png?v=1539139432Blackstone Labs new 520100380723in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 29.00GBP shopify_369634705445_4714161864741Hype extreme  hype extremedramatically increases n.o. production and vascularitystimulant free descriptionthe pump is the stuff of legend. ever since arnold discussed the phenomenon in pumping iron, the pump has been the driving force behind many a workout. lifters train relentlessly all in the hopes of capturing the ultimate muscle pump, the kind where your sleeves are busting and veins are bursting through your skin. the pump is an elusive beast, one the eludes even the most hardcore lifters out there...but not anymore.hype extreme from blackstone labs is the ultimate muscle-swelling, vein-gorging, and sleeve-busting pre workout on the market. hype extreme is stimulant free and provides a robust combination of nitric oxide boosting ingredients to generate a raging pump that lasts all day long. blackstone labs has also included a hefty dose of nootropics to combat mental fatigue and enhance focus in the midst of your battle against the iron.pumps, focus, endurance -- hype extreme delivers it all! ingredientshydromax (2g) is the premier form of glycerol supplement on the market that drives extra water and nutrients into your muscle cells. hydromax aids hydration, stamina, endurance, and also yields some pretty epic water-based pumps too!sodium nitrate (1.5g) creates a powerful surge in nitric oxide production. nitrates are 100% bioavailable and can increase plasma no levels by 138%, delivering significant vascularity and blood flow to working muscles leading to a massive muscle pump.rhodiola rosea (300mg) eases mental and physical fatigue during intense exercise, leading to greater performance. as an adaptogen, rhodiola also combats stress, keeping you calm, cool, and collected in the face of adversity.alpha gpc (250mg) fosters a strong mind-muscle connection by increasing levels of the neurotransmitter acetylcholine, a.k.a. “the learning neurotransmitter.” with alpha gpc, you’ll feel every muscle fiber becoming engorged as you grind out rep after rep.huperzine a (300mcg) supports acetylcholine production in the body by inhibiting acetylcholinesterase, the enzyme that degrades acetylcholine. the 1-2 punch of huperzine and alpha gpc promote incredibly strong, long-lasting focus that delivers tunnel vision like you’ve never experienced before. instructionsas a dietary supplement, take one (1) scoop mixed with 8 oz. of water, 30 minutes before a workout. do not exceed one (1) scoop in a 24 hour period.https://redsupps.co.uk/products/blackstone-labs-hype-extremehttps://cdn.shopify.com/s/files/1/2544/1734/products/hypeextreme-cottoncandy_600x600_crop_center.png?v=1539139560Blackstone Labs new 369634705445in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 32.99GBP shopify_369634705445_4714161897509Hype extreme  hype extremedramatically increases n.o. production and vascularitystimulant free descriptionthe pump is the stuff of legend. ever since arnold discussed the phenomenon in pumping iron, the pump has been the driving force behind many a workout. lifters train relentlessly all in the hopes of capturing the ultimate muscle pump, the kind where your sleeves are busting and veins are bursting through your skin. the pump is an elusive beast, one the eludes even the most hardcore lifters out there...but not anymore.hype extreme from blackstone labs is the ultimate muscle-swelling, vein-gorging, and sleeve-busting pre workout on the market. hype extreme is stimulant free and provides a robust combination of nitric oxide boosting ingredients to generate a raging pump that lasts all day long. blackstone labs has also included a hefty dose of nootropics to combat mental fatigue and enhance focus in the midst of your battle against the iron.pumps, focus, endurance -- hype extreme delivers it all! ingredientshydromax (2g) is the premier form of glycerol supplement on the market that drives extra water and nutrients into your muscle cells. hydromax aids hydration, stamina, endurance, and also yields some pretty epic water-based pumps too!sodium nitrate (1.5g) creates a powerful surge in nitric oxide production. nitrates are 100% bioavailable and can increase plasma no levels by 138%, delivering significant vascularity and blood flow to working muscles leading to a massive muscle pump.rhodiola rosea (300mg) eases mental and physical fatigue during intense exercise, leading to greater performance. as an adaptogen, rhodiola also combats stress, keeping you calm, cool, and collected in the face of adversity.alpha gpc (250mg) fosters a strong mind-muscle connection by increasing levels of the neurotransmitter acetylcholine, a.k.a. “the learning neurotransmitter.” with alpha gpc, you’ll feel every muscle fiber becoming engorged as you grind out rep after rep.huperzine a (300mcg) supports acetylcholine production in the body by inhibiting acetylcholinesterase, the enzyme that degrades acetylcholine. the 1-2 punch of huperzine and alpha gpc promote incredibly strong, long-lasting focus that delivers tunnel vision like you’ve never experienced before. instructionsas a dietary supplement, take one (1) scoop mixed with 8 oz. of water, 30 minutes before a workout. do not exceed one (1) scoop in a 24 hour period.https://redsupps.co.uk/products/blackstone-labs-hype-extremehttps://cdn.shopify.com/s/files/1/2544/1734/products/hypeextreme-cottoncandy_600x600_crop_center.png?v=1539139560Blackstone Labs new 369634705445in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 32.99GBP shopify_522457677875_7019656216627Illa benefitsbuild lean muscle †hydration  †muscle recovery †increase strength †utilizing exclusive peptide technology from the eastern bloc and becoming more well known for our quality and unorthodox formulas, we proudly use a one of a kind recovery formula composed of micro-peptide infused fermented bcaa’s (micraminos™). packed with himalayan pink salt, non-gmo coconut water powder and albion® minerals (the worlds leader in mineral innovation) to keep your body hydrated for performance. illa® contains the highest quality of recovery and replenishing specific nutrients under one lid. elevate stamina strength, muscle gains and recovery to the next level with illa®. replenish. rebuild. recover.™ †https://redsupps.co.uk/products/illahttps://cdn.shopify.com/s/files/1/2544/1734/products/Illa_1024x_ce2f47d4-4c1f-498d-b908-4bf0433a8eec_600x600_crop_center.jpg?v=1539139589MYOBLOX new 522457677875in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids 29.00GBP shopify_522457677875_7019656249395Illa benefitsbuild lean muscle †hydration  †muscle recovery †increase strength †utilizing exclusive peptide technology from the eastern bloc and becoming more well known for our quality and unorthodox formulas, we proudly use a one of a kind recovery formula composed of micro-peptide infused fermented bcaa’s (micraminos™). packed with himalayan pink salt, non-gmo coconut water powder and albion® minerals (the worlds leader in mineral innovation) to keep your body hydrated for performance. illa® contains the highest quality of recovery and replenishing specific nutrients under one lid. elevate stamina strength, muscle gains and recovery to the next level with illa®. replenish. rebuild. recover.™ †https://redsupps.co.uk/products/illahttps://cdn.shopify.com/s/files/1/2544/1734/products/Illa_1024x_ce2f47d4-4c1f-498d-b908-4bf0433a8eec_600x600_crop_center.jpg?v=1539139589MYOBLOX new 522457677875in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids 29.00GBP shopify_522457677875_7019656282163Illa benefitsbuild lean muscle †hydration  †muscle recovery †increase strength †utilizing exclusive peptide technology from the eastern bloc and becoming more well known for our quality and unorthodox formulas, we proudly use a one of a kind recovery formula composed of micro-peptide infused fermented bcaa’s (micraminos™). packed with himalayan pink salt, non-gmo coconut water powder and albion® minerals (the worlds leader in mineral innovation) to keep your body hydrated for performance. illa® contains the highest quality of recovery and replenishing specific nutrients under one lid. elevate stamina strength, muscle gains and recovery to the next level with illa®. replenish. rebuild. recover.™ †https://redsupps.co.uk/products/illahttps://cdn.shopify.com/s/files/1/2544/1734/products/Illa_1024x_ce2f47d4-4c1f-498d-b908-4bf0433a8eec_600x600_crop_center.jpg?v=1539139589MYOBLOX new 522457677875in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsAmino Acids 29.00GBP shopify_733886677043_8707681615923Inferno  descriptionthermogenic fat burners and weight loss products today have become incredibly generic. every formula produced today is the same: an overdose of stimulants to make you "feel" like it's working, but, cost-conscious cutting of key fat burning ingredients fail to provide true weight loss results. not only are they not effective, but the extreme doses of caffeine or other stimulants has become downright dangerous.we wanted to create a true stimulant and caffeine free weight loss product based today's science, not yesterday's fad or trend. you won't find ridiculous claims about raspberry ketones or garcinia cambogia in inferno. what you will find is scientifically validated ingredients properly dosed to create an extremely versatile and effective fat burner.https://redsupps.co.uk/products/infernohttps://cdn.shopify.com/s/files/1/2544/1734/products/inferno_1_600x600_crop_center.png?v=1539139596SPARTA NUTRITION new 733886677043in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsNon Stimulant Fat Burner 29.99GBP shopify_522462593075_7019729551411Isofract benefitscold-filtration whey isolate †support protein synthesis †pasture-fed/non-gmo †less than 1g of sugar †less than 1g of fat †this delicate, cold filtered undenatured protein is superior to your average protein powder. we made absolutely sure that this special protein was treated with complete care through its entire meticulous manufacturing process to yield you something that is truly nourishing to your physique.  even for those who are lactose intolerant and have trouble with even the cleanest proteins, isofract® supplies the body with an extremely digestible protein. this protein also contains the highest level of naturally occurring body fortifying, cell regenerating, lean muscle tissue building and immune system-enhancing bioactive macrofractions: immunoglobulin, lactoferrin and glycomacropeptides. on top of the obvious benefits, isofract® is instantized, and in turn mixes easily without clumping. experience a mouth-watering taste of perfection without the guilt. you take your training seriously, and it is only right to take your protein supplementation seriously. †* note: isofract® nutrition facts can slightly vary from flavor to flavor.https://redsupps.co.uk/products/isofracthttps://cdn.shopify.com/s/files/1/2544/1734/products/ISOFRACT-B-DAY-MOCKUP_1024x_35f4a4ad-ca3a-4beb-8de1-aeee501cb2a0_600x600_crop_center.jpg?v=1539139618MYOBLOX new 522462593075in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Blend 37.50GBP shopify_522462593075_7019729584179Isofract benefitscold-filtration whey isolate †support protein synthesis †pasture-fed/non-gmo †less than 1g of sugar †less than 1g of fat †this delicate, cold filtered undenatured protein is superior to your average protein powder. we made absolutely sure that this special protein was treated with complete care through its entire meticulous manufacturing process to yield you something that is truly nourishing to your physique.  even for those who are lactose intolerant and have trouble with even the cleanest proteins, isofract® supplies the body with an extremely digestible protein. this protein also contains the highest level of naturally occurring body fortifying, cell regenerating, lean muscle tissue building and immune system-enhancing bioactive macrofractions: immunoglobulin, lactoferrin and glycomacropeptides. on top of the obvious benefits, isofract® is instantized, and in turn mixes easily without clumping. experience a mouth-watering taste of perfection without the guilt. you take your training seriously, and it is only right to take your protein supplementation seriously. †* note: isofract® nutrition facts can slightly vary from flavor to flavor.https://redsupps.co.uk/products/isofracthttps://cdn.shopify.com/s/files/1/2544/1734/products/ISOFRACT-B-DAY-MOCKUP_1024x_35f4a4ad-ca3a-4beb-8de1-aeee501cb2a0_600x600_crop_center.jpg?v=1539139618MYOBLOX new 522462593075in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Blend 37.50GBP shopify_522462593075_8361964175411Isofract benefitscold-filtration whey isolate †support protein synthesis †pasture-fed/non-gmo †less than 1g of sugar †less than 1g of fat †this delicate, cold filtered undenatured protein is superior to your average protein powder. we made absolutely sure that this special protein was treated with complete care through its entire meticulous manufacturing process to yield you something that is truly nourishing to your physique.  even for those who are lactose intolerant and have trouble with even the cleanest proteins, isofract® supplies the body with an extremely digestible protein. this protein also contains the highest level of naturally occurring body fortifying, cell regenerating, lean muscle tissue building and immune system-enhancing bioactive macrofractions: immunoglobulin, lactoferrin and glycomacropeptides. on top of the obvious benefits, isofract® is instantized, and in turn mixes easily without clumping. experience a mouth-watering taste of perfection without the guilt. you take your training seriously, and it is only right to take your protein supplementation seriously. †* note: isofract® nutrition facts can slightly vary from flavor to flavor.https://redsupps.co.uk/products/isofracthttps://cdn.shopify.com/s/files/1/2544/1734/products/ISOFRACT-B-DAY-MOCKUP_1024x_35f4a4ad-ca3a-4beb-8de1-aeee501cb2a0_600x600_crop_center.jpg?v=1539139618MYOBLOX new 522462593075in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Blend 37.50GBP shopify_473660031013_5237602910245Isolation isolation 2 lbs100% whey isolategreat flavor, mixes easily descriptionprotein is the lifeblood of muscle growth. no matter how hard you train, without adequate protein, your muscles simply won’t grow. after a grueling workout, you need to slam your muscles with a high quality protein as fast as possible to stop muscle breakdown and kickstart repair and growth.isolation is 100% pure whey protein isolate, the highest quality form of whey protein on the market. each scoop of isolation delivers 24g of pure muscle-building protein including 5.5g of branched chain amino acids (bcaa's), which support muscle metabolism. isolation is not amino spiked and provides only the purest whey protein possible to help your body build, repair, and most importantly, grow. ingredientswhey protein isolate is the purest form of whey protein containing a minimum of 90% protein, with virtually no carbs, lactose, or fat. whey protein isolate is rapid digesting, delivering the essential amino acids your muscles need immediately following an intense workout. isolation is quick, convenient, and above all, delicious. it mixes easily with a spoon or in a shaker and never clumps or leaves gobs of unmixed protein on the sides of your shaker. simply put, isolation is the cleanest, best tasting protein drink on the market. instructionsas a dietary supplement, mix one to two (1-2) scoops in 6-8 oz. of water.https://redsupps.co.uk/products/isolationhttps://cdn.shopify.com/s/files/1/2544/1734/products/isolation-chocolate_600x600_crop_center.png?v=1539139642Blackstone Labs new 473660031013in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Isolate 34.00GBP shopify_473660031013_5237602943013Isolation isolation 2 lbs100% whey isolategreat flavor, mixes easily descriptionprotein is the lifeblood of muscle growth. no matter how hard you train, without adequate protein, your muscles simply won’t grow. after a grueling workout, you need to slam your muscles with a high quality protein as fast as possible to stop muscle breakdown and kickstart repair and growth.isolation is 100% pure whey protein isolate, the highest quality form of whey protein on the market. each scoop of isolation delivers 24g of pure muscle-building protein including 5.5g of branched chain amino acids (bcaa's), which support muscle metabolism. isolation is not amino spiked and provides only the purest whey protein possible to help your body build, repair, and most importantly, grow. ingredientswhey protein isolate is the purest form of whey protein containing a minimum of 90% protein, with virtually no carbs, lactose, or fat. whey protein isolate is rapid digesting, delivering the essential amino acids your muscles need immediately following an intense workout. isolation is quick, convenient, and above all, delicious. it mixes easily with a spoon or in a shaker and never clumps or leaves gobs of unmixed protein on the sides of your shaker. simply put, isolation is the cleanest, best tasting protein drink on the market. instructionsas a dietary supplement, mix one to two (1-2) scoops in 6-8 oz. of water.https://redsupps.co.uk/products/isolationhttps://cdn.shopify.com/s/files/1/2544/1734/products/isolation-chocolate_600x600_crop_center.png?v=1539139642Blackstone Labs new 473660031013in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Isolate 34.00GBP shopify_369635950629_4714166550565Juiced up benefitspacked with essential vitaminsstregthens immune function descriptioneveryone knows they need to eat more fruits and veggies. the problem is, after suffering from decades of bland, mushy, overcooked produce, you’re left with more disdain for it than the guy doing curls in the squat rack!blackstone labs has the solution to your fruit and veggie needs in juiced up. yes, protein and carbs are necessary to building a massive physique, but if your insides are rotting away, all those muscles won’t do a lick of good. juiced up is packed with 100% micronized fruits, veggies, fiber, minerals, and antioxidants that will help fight off any free radical present in your body, defending you from the harsh effects of oxidative stress.juiced up is the strongest and most powerful fruit and veggie blend available. plus, you’ll actually enjoy getting in your greens as juiced up tastes amazing. no grassy, chalky, or chunky texture like so many other greens formulas on the market. fuel your insides so they're as powerful as your outside with juiced up. ingredientsgreens blend contains a comprehensive collection of known superfoods including: blueberry, black raspberry, mulberry, pineapple powder, bilberry, papaya, camu camu, luo han guo (monk fruit), broccoli powder, carrot powder, purple sweet potato, kelp, fos, chlorella, papain, bromelain, pqq, and acai extract. these superfoods provide essential micronutrients your body needs to defend against free radicals, combat inflammation, and support total body health and wellness.capsorb enables maximum absorption of each nutrient in juiced up. this proprietary ingredient enhances the bioavailability of all the key nutrients contained in juiced up so that nothing goes to waste. capsorb is your insurance that what you put into your body actually gets utilized for maximum effectiveness, promoting superior health. instructionsas a dietary supplement, mix one (1) scoop in 10-12 oz. of water.https://redsupps.co.uk/products/blackstone-labs-juiced-uphttps://cdn.shopify.com/s/files/1/2544/1734/products/juicedup-banginberries_1eee96e9-37de-4f79-b08d-fbb32a81807e_600x600_crop_center.png?v=1539139655Blackstone Labs new 369635950629in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsFruits & Greens 29.99GBP shopify_619558666291_7776514474035Kraken extreme pre-workout  descriptionit’s time to take your workouts to the next level, crank the intensity up a notch (or ten) and break free from the outdated barriers of the past. it’s a new era and we’re the pioneers of breaking the molds of the past and re-defining sports nutrition.in the simplest form, kraken was formulated to perform without cutting any corners or costs; featuring premier patented and trademarked ingredients coupled with clinical dosages of essential pre-workout ingredients, kraken will help you perform at the highest capacity.kraken was scientifically formulated to offer a full - fledged pre - workout priming experience like no other. from the carefully dosed selection of energy providing ingredients like teacrine® and cocoabuterol® to scientifically proven muscle pump inducing ingredients like vaso6™ and hydromax® , kraken hits every angle a pre-workout attempts to cover. ingredientsl-citrulline is known to delay the early onset of fatigue during rigorous training and activity, as well as a precursor to nitric oxide to produce unparalleled pumps. we packed kraken with 4 grams of l-citrulline to give you the true clinical dosage which also enhances circulation and vasodilation.beta-alanine is one of the most formidable endurance ingredients out there on the market. the "tingles" are a clear sign that the ingredient is working and putting your muscles to use!hydromax® is easily absorbed and allocated through intercellular space, increasing the concentration of fluid in the blood and tissues, directly affecting the expansion and maintenance of fluid volume. hydromax® enhances intramuscular volume, increasing that swollen muscular appearance – also known as the pump.n-acetyl-l-tyrosine (nalt) is regarded as a “focus” ingredient that is used by many people to support stress reduction, and enhance your mood.vaso-6™ is a proprietary trademarked natural extract of grape seed and green tea containing the most potent nitric oxide (no)-activating fractions in them. vaso6™ also increases blood flow, clinically proven to increase vasodilation.teacrine® (tasteless 40%) is the ultimate ingredient for focus, concentration, and long-lasting energy to break through performance plateaus, while keeping you in control with no crash. teacrine® may also help reduce caffeine habituation and tolerance.caffeine anhydrous is arguably one of the most widely used ingredients globally, as it has a number of benefits. 250mg is more than enough caffeine to get you going. unlike other pre-workouts, we do not rely on a boatload of caffeine. in fact, we pride ourselves in this relatively low dosage of caffeine synergistically workingwith teacrine®.theobromine is an alkaloid structurally similar to caffeine, derived from cacao, providing more smooth and sustained energy.n-methyl tyramine hcl (nmt) acts as a beta-2 agonist in the body. beta agonists stimulate the “flight or fight” response that provides a mild boost in adrenaline, which increases energy.cocoabuterol® is naturally derived from cocoa, and the base of cocaobuterol® is n-coumaroyldopamine and n-caffeoyldopamine, which target β2 adrenoceptors helping increase focus and energy.https://redsupps.co.uk/products/kraken-extreme-pre-workouthttps://cdn.shopify.com/s/files/1/2544/1734/products/kraken_rainbow_1_600x600_crop_center.png?v=1539632393SPARTA NUTRITION new 619558666291in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 34.00GBP shopify_619558666291_7776514506803Kraken extreme pre-workout  descriptionit’s time to take your workouts to the next level, crank the intensity up a notch (or ten) and break free from the outdated barriers of the past. it’s a new era and we’re the pioneers of breaking the molds of the past and re-defining sports nutrition.in the simplest form, kraken was formulated to perform without cutting any corners or costs; featuring premier patented and trademarked ingredients coupled with clinical dosages of essential pre-workout ingredients, kraken will help you perform at the highest capacity.kraken was scientifically formulated to offer a full - fledged pre - workout priming experience like no other. from the carefully dosed selection of energy providing ingredients like teacrine® and cocoabuterol® to scientifically proven muscle pump inducing ingredients like vaso6™ and hydromax® , kraken hits every angle a pre-workout attempts to cover. ingredientsl-citrulline is known to delay the early onset of fatigue during rigorous training and activity, as well as a precursor to nitric oxide to produce unparalleled pumps. we packed kraken with 4 grams of l-citrulline to give you the true clinical dosage which also enhances circulation and vasodilation.beta-alanine is one of the most formidable endurance ingredients out there on the market. the "tingles" are a clear sign that the ingredient is working and putting your muscles to use!hydromax® is easily absorbed and allocated through intercellular space, increasing the concentration of fluid in the blood and tissues, directly affecting the expansion and maintenance of fluid volume. hydromax® enhances intramuscular volume, increasing that swollen muscular appearance – also known as the pump.n-acetyl-l-tyrosine (nalt) is regarded as a “focus” ingredient that is used by many people to support stress reduction, and enhance your mood.vaso-6™ is a proprietary trademarked natural extract of grape seed and green tea containing the most potent nitric oxide (no)-activating fractions in them. vaso6™ also increases blood flow, clinically proven to increase vasodilation.teacrine® (tasteless 40%) is the ultimate ingredient for focus, concentration, and long-lasting energy to break through performance plateaus, while keeping you in control with no crash. teacrine® may also help reduce caffeine habituation and tolerance.caffeine anhydrous is arguably one of the most widely used ingredients globally, as it has a number of benefits. 250mg is more than enough caffeine to get you going. unlike other pre-workouts, we do not rely on a boatload of caffeine. in fact, we pride ourselves in this relatively low dosage of caffeine synergistically workingwith teacrine®.theobromine is an alkaloid structurally similar to caffeine, derived from cacao, providing more smooth and sustained energy.n-methyl tyramine hcl (nmt) acts as a beta-2 agonist in the body. beta agonists stimulate the “flight or fight” response that provides a mild boost in adrenaline, which increases energy.cocoabuterol® is naturally derived from cocoa, and the base of cocaobuterol® is n-coumaroyldopamine and n-caffeoyldopamine, which target β2 adrenoceptors helping increase focus and energy.https://redsupps.co.uk/products/kraken-extreme-pre-workouthttps://cdn.shopify.com/s/files/1/2544/1734/products/kraken_rainbow_1_600x600_crop_center.png?v=1539632393SPARTA NUTRITION new 619558666291in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 34.00GBP shopify_619558666291_7826068373555Kraken extreme pre-workout  descriptionit’s time to take your workouts to the next level, crank the intensity up a notch (or ten) and break free from the outdated barriers of the past. it’s a new era and we’re the pioneers of breaking the molds of the past and re-defining sports nutrition.in the simplest form, kraken was formulated to perform without cutting any corners or costs; featuring premier patented and trademarked ingredients coupled with clinical dosages of essential pre-workout ingredients, kraken will help you perform at the highest capacity.kraken was scientifically formulated to offer a full - fledged pre - workout priming experience like no other. from the carefully dosed selection of energy providing ingredients like teacrine® and cocoabuterol® to scientifically proven muscle pump inducing ingredients like vaso6™ and hydromax® , kraken hits every angle a pre-workout attempts to cover. ingredientsl-citrulline is known to delay the early onset of fatigue during rigorous training and activity, as well as a precursor to nitric oxide to produce unparalleled pumps. we packed kraken with 4 grams of l-citrulline to give you the true clinical dosage which also enhances circulation and vasodilation.beta-alanine is one of the most formidable endurance ingredients out there on the market. the "tingles" are a clear sign that the ingredient is working and putting your muscles to use!hydromax® is easily absorbed and allocated through intercellular space, increasing the concentration of fluid in the blood and tissues, directly affecting the expansion and maintenance of fluid volume. hydromax® enhances intramuscular volume, increasing that swollen muscular appearance – also known as the pump.n-acetyl-l-tyrosine (nalt) is regarded as a “focus” ingredient that is used by many people to support stress reduction, and enhance your mood.vaso-6™ is a proprietary trademarked natural extract of grape seed and green tea containing the most potent nitric oxide (no)-activating fractions in them. vaso6™ also increases blood flow, clinically proven to increase vasodilation.teacrine® (tasteless 40%) is the ultimate ingredient for focus, concentration, and long-lasting energy to break through performance plateaus, while keeping you in control with no crash. teacrine® may also help reduce caffeine habituation and tolerance.caffeine anhydrous is arguably one of the most widely used ingredients globally, as it has a number of benefits. 250mg is more than enough caffeine to get you going. unlike other pre-workouts, we do not rely on a boatload of caffeine. in fact, we pride ourselves in this relatively low dosage of caffeine synergistically workingwith teacrine®.theobromine is an alkaloid structurally similar to caffeine, derived from cacao, providing more smooth and sustained energy.n-methyl tyramine hcl (nmt) acts as a beta-2 agonist in the body. beta agonists stimulate the “flight or fight” response that provides a mild boost in adrenaline, which increases energy.cocoabuterol® is naturally derived from cocoa, and the base of cocaobuterol® is n-coumaroyldopamine and n-caffeoyldopamine, which target β2 adrenoceptors helping increase focus and energy.https://redsupps.co.uk/products/kraken-extreme-pre-workouthttps://cdn.shopify.com/s/files/1/2544/1734/products/kraken_rainbow_1_600x600_crop_center.png?v=1539632393SPARTA NUTRITION new 619558666291in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 34.00GBP shopify_619558666291_7855392686131Kraken extreme pre-workout  descriptionit’s time to take your workouts to the next level, crank the intensity up a notch (or ten) and break free from the outdated barriers of the past. it’s a new era and we’re the pioneers of breaking the molds of the past and re-defining sports nutrition.in the simplest form, kraken was formulated to perform without cutting any corners or costs; featuring premier patented and trademarked ingredients coupled with clinical dosages of essential pre-workout ingredients, kraken will help you perform at the highest capacity.kraken was scientifically formulated to offer a full - fledged pre - workout priming experience like no other. from the carefully dosed selection of energy providing ingredients like teacrine® and cocoabuterol® to scientifically proven muscle pump inducing ingredients like vaso6™ and hydromax® , kraken hits every angle a pre-workout attempts to cover. ingredientsl-citrulline is known to delay the early onset of fatigue during rigorous training and activity, as well as a precursor to nitric oxide to produce unparalleled pumps. we packed kraken with 4 grams of l-citrulline to give you the true clinical dosage which also enhances circulation and vasodilation.beta-alanine is one of the most formidable endurance ingredients out there on the market. the "tingles" are a clear sign that the ingredient is working and putting your muscles to use!hydromax® is easily absorbed and allocated through intercellular space, increasing the concentration of fluid in the blood and tissues, directly affecting the expansion and maintenance of fluid volume. hydromax® enhances intramuscular volume, increasing that swollen muscular appearance – also known as the pump.n-acetyl-l-tyrosine (nalt) is regarded as a “focus” ingredient that is used by many people to support stress reduction, and enhance your mood.vaso-6™ is a proprietary trademarked natural extract of grape seed and green tea containing the most potent nitric oxide (no)-activating fractions in them. vaso6™ also increases blood flow, clinically proven to increase vasodilation.teacrine® (tasteless 40%) is the ultimate ingredient for focus, concentration, and long-lasting energy to break through performance plateaus, while keeping you in control with no crash. teacrine® may also help reduce caffeine habituation and tolerance.caffeine anhydrous is arguably one of the most widely used ingredients globally, as it has a number of benefits. 250mg is more than enough caffeine to get you going. unlike other pre-workouts, we do not rely on a boatload of caffeine. in fact, we pride ourselves in this relatively low dosage of caffeine synergistically workingwith teacrine®.theobromine is an alkaloid structurally similar to caffeine, derived from cacao, providing more smooth and sustained energy.n-methyl tyramine hcl (nmt) acts as a beta-2 agonist in the body. beta agonists stimulate the “flight or fight” response that provides a mild boost in adrenaline, which increases energy.cocoabuterol® is naturally derived from cocoa, and the base of cocaobuterol® is n-coumaroyldopamine and n-caffeoyldopamine, which target β2 adrenoceptors helping increase focus and energy.https://redsupps.co.uk/products/kraken-extreme-pre-workouthttps://cdn.shopify.com/s/files/1/2544/1734/products/kraken_rainbow_1_600x600_crop_center.png?v=1539632393SPARTA NUTRITION new 619558666291in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 34.00GBP shopify_619558666291_7855395012659Kraken extreme pre-workout  descriptionit’s time to take your workouts to the next level, crank the intensity up a notch (or ten) and break free from the outdated barriers of the past. it’s a new era and we’re the pioneers of breaking the molds of the past and re-defining sports nutrition.in the simplest form, kraken was formulated to perform without cutting any corners or costs; featuring premier patented and trademarked ingredients coupled with clinical dosages of essential pre-workout ingredients, kraken will help you perform at the highest capacity.kraken was scientifically formulated to offer a full - fledged pre - workout priming experience like no other. from the carefully dosed selection of energy providing ingredients like teacrine® and cocoabuterol® to scientifically proven muscle pump inducing ingredients like vaso6™ and hydromax® , kraken hits every angle a pre-workout attempts to cover. ingredientsl-citrulline is known to delay the early onset of fatigue during rigorous training and activity, as well as a precursor to nitric oxide to produce unparalleled pumps. we packed kraken with 4 grams of l-citrulline to give you the true clinical dosage which also enhances circulation and vasodilation.beta-alanine is one of the most formidable endurance ingredients out there on the market. the "tingles" are a clear sign that the ingredient is working and putting your muscles to use!hydromax® is easily absorbed and allocated through intercellular space, increasing the concentration of fluid in the blood and tissues, directly affecting the expansion and maintenance of fluid volume. hydromax® enhances intramuscular volume, increasing that swollen muscular appearance – also known as the pump.n-acetyl-l-tyrosine (nalt) is regarded as a “focus” ingredient that is used by many people to support stress reduction, and enhance your mood.vaso-6™ is a proprietary trademarked natural extract of grape seed and green tea containing the most potent nitric oxide (no)-activating fractions in them. vaso6™ also increases blood flow, clinically proven to increase vasodilation.teacrine® (tasteless 40%) is the ultimate ingredient for focus, concentration, and long-lasting energy to break through performance plateaus, while keeping you in control with no crash. teacrine® may also help reduce caffeine habituation and tolerance.caffeine anhydrous is arguably one of the most widely used ingredients globally, as it has a number of benefits. 250mg is more than enough caffeine to get you going. unlike other pre-workouts, we do not rely on a boatload of caffeine. in fact, we pride ourselves in this relatively low dosage of caffeine synergistically workingwith teacrine®.theobromine is an alkaloid structurally similar to caffeine, derived from cacao, providing more smooth and sustained energy.n-methyl tyramine hcl (nmt) acts as a beta-2 agonist in the body. beta agonists stimulate the “flight or fight” response that provides a mild boost in adrenaline, which increases energy.cocoabuterol® is naturally derived from cocoa, and the base of cocaobuterol® is n-coumaroyldopamine and n-caffeoyldopamine, which target β2 adrenoceptors helping increase focus and energy.https://redsupps.co.uk/products/kraken-extreme-pre-workouthttps://cdn.shopify.com/s/files/1/2544/1734/products/kraken_rainbow_1_600x600_crop_center.png?v=1539632393SPARTA NUTRITION new 619558666291in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 34.00GBP shopify_619558666291_8706989817907Kraken extreme pre-workout  descriptionit’s time to take your workouts to the next level, crank the intensity up a notch (or ten) and break free from the outdated barriers of the past. it’s a new era and we’re the pioneers of breaking the molds of the past and re-defining sports nutrition.in the simplest form, kraken was formulated to perform without cutting any corners or costs; featuring premier patented and trademarked ingredients coupled with clinical dosages of essential pre-workout ingredients, kraken will help you perform at the highest capacity.kraken was scientifically formulated to offer a full - fledged pre - workout priming experience like no other. from the carefully dosed selection of energy providing ingredients like teacrine® and cocoabuterol® to scientifically proven muscle pump inducing ingredients like vaso6™ and hydromax® , kraken hits every angle a pre-workout attempts to cover. ingredientsl-citrulline is known to delay the early onset of fatigue during rigorous training and activity, as well as a precursor to nitric oxide to produce unparalleled pumps. we packed kraken with 4 grams of l-citrulline to give you the true clinical dosage which also enhances circulation and vasodilation.beta-alanine is one of the most formidable endurance ingredients out there on the market. the "tingles" are a clear sign that the ingredient is working and putting your muscles to use!hydromax® is easily absorbed and allocated through intercellular space, increasing the concentration of fluid in the blood and tissues, directly affecting the expansion and maintenance of fluid volume. hydromax® enhances intramuscular volume, increasing that swollen muscular appearance – also known as the pump.n-acetyl-l-tyrosine (nalt) is regarded as a “focus” ingredient that is used by many people to support stress reduction, and enhance your mood.vaso-6™ is a proprietary trademarked natural extract of grape seed and green tea containing the most potent nitric oxide (no)-activating fractions in them. vaso6™ also increases blood flow, clinically proven to increase vasodilation.teacrine® (tasteless 40%) is the ultimate ingredient for focus, concentration, and long-lasting energy to break through performance plateaus, while keeping you in control with no crash. teacrine® may also help reduce caffeine habituation and tolerance.caffeine anhydrous is arguably one of the most widely used ingredients globally, as it has a number of benefits. 250mg is more than enough caffeine to get you going. unlike other pre-workouts, we do not rely on a boatload of caffeine. in fact, we pride ourselves in this relatively low dosage of caffeine synergistically workingwith teacrine®.theobromine is an alkaloid structurally similar to caffeine, derived from cacao, providing more smooth and sustained energy.n-methyl tyramine hcl (nmt) acts as a beta-2 agonist in the body. beta agonists stimulate the “flight or fight” response that provides a mild boost in adrenaline, which increases energy.cocoabuterol® is naturally derived from cocoa, and the base of cocaobuterol® is n-coumaroyldopamine and n-caffeoyldopamine, which target β2 adrenoceptors helping increase focus and energy.https://redsupps.co.uk/products/kraken-extreme-pre-workouthttps://cdn.shopify.com/s/files/1/2544/1734/products/kraken_rainbow_1_600x600_crop_center.png?v=1539632393SPARTA NUTRITION new 619558666291in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 34.00GBP shopify_619625938995_7776754532403Kraken pump non stimulant pre-workout  descriptionsparta nutrition brings you the ultimate caffeine and stimulant-free nitric oxide boosting pre workout: kraken pump. you haven’t experienced muscle pumps and vascularity until you have tried kraken pump. with large doses of l-citrulline, hydromax, and nitrosigine, nitric oxide levels are boosted and maintained to provide enhanced blood flow to your muscles. a more full muscle can experience skin tearing pumps and better nutrient utilization for lean muscle mass growth.kraken pump doesn’t stop at increasing no2: we at sparta nutrition went above and beyond by adding a very unique addition in coconut water. coconut water is very well known for its ability to hydrate cells at a higher rate. a more hydrated muscle can better effectively contract, allowing for intense muscle pumps. a more hydrated muscle can also better effectively utilise nutrients to grow lean muscle mass and allow you to train longer and harder. ingredientskraken pump features incredibly high doses of some of the most novel and clinically proven nitric oxide boosting ingredients todayl-citrullinetwo scoops of kraken pump provides 6 grams (6!) of one of the most popular muscle pump inducing ingredients, l-citrulline. your muscles will feel full and pumped to the max. l-citrulline is the go-to nitric oxide (n.o.) boosting ingredient on the market today for strong, dense pumps. the reason we’re such fans of l-citrulline is that it’s heads and tails better than l-arginine in terms of elevating n.o. levels.  this translates to bigger, badder, and better pumps during your workouts.hydromaxessential to a good workout is proper muscle hydration. hydromax ensures your muscles are hydrated enough to maximize performance and muscle contractions. in essence, hydromax® essentially turns your muscles into ultra absorbent sponges that soak up tons of extra water. this creates a state of “hyperhydration” in the muscle which leads to greater overall endurance in your workout and lays the groundwork for those water-based pumps we first mentioned.nitrosigineclinically validated at maximizing nitric oxide levels, nitrosigine is a novel ingredients designed to promote enhanced blood flow to your muscles. as one of the most potent and clinically proven nitric oxide boosting ingredients, it was a no brainer to include nitrosigine at the clinical dose of 1,500 mg. this leads to skin-splitting pumps and better nutrient delivery.coconut waterunique in the nitric oxide boosting game is the use of coconut water powder. coconut water is well known for its hydration benefits, and a properly hydrated muscle can contract better, which leads to more intense muscle pumps and contractions. coconut waters hydration benefits are also perfect to help mitigate cramping and can help normalize electrolyte balance.clinically validated n.o. boosting ingredients at massive doses are a staple in kraken pump: beetroot, hydromax glycerol, and nitrosigine offer unparalleled muscle pumps and increased vascularity. toss in a whopping 6 grams of l-citrulline and a super hydrated muscle cell from coconut water and kraken pump will make every workout a nitric oxide boosting and muscle swelling adventure.https://redsupps.co.uk/products/kraken-pump-non-stimulant-pre-workouthttps://cdn.shopify.com/s/files/1/2544/1734/products/kraken_pump_gummy_1_600x600_crop_center.png?v=1539632842SPARTA NUTRITION new 619625938995in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 32.99GBP shopify_619625938995_7776754565171Kraken pump non stimulant pre-workout  descriptionsparta nutrition brings you the ultimate caffeine and stimulant-free nitric oxide boosting pre workout: kraken pump. you haven’t experienced muscle pumps and vascularity until you have tried kraken pump. with large doses of l-citrulline, hydromax, and nitrosigine, nitric oxide levels are boosted and maintained to provide enhanced blood flow to your muscles. a more full muscle can experience skin tearing pumps and better nutrient utilization for lean muscle mass growth.kraken pump doesn’t stop at increasing no2: we at sparta nutrition went above and beyond by adding a very unique addition in coconut water. coconut water is very well known for its ability to hydrate cells at a higher rate. a more hydrated muscle can better effectively contract, allowing for intense muscle pumps. a more hydrated muscle can also better effectively utilise nutrients to grow lean muscle mass and allow you to train longer and harder. ingredientskraken pump features incredibly high doses of some of the most novel and clinically proven nitric oxide boosting ingredients todayl-citrullinetwo scoops of kraken pump provides 6 grams (6!) of one of the most popular muscle pump inducing ingredients, l-citrulline. your muscles will feel full and pumped to the max. l-citrulline is the go-to nitric oxide (n.o.) boosting ingredient on the market today for strong, dense pumps. the reason we’re such fans of l-citrulline is that it’s heads and tails better than l-arginine in terms of elevating n.o. levels.  this translates to bigger, badder, and better pumps during your workouts.hydromaxessential to a good workout is proper muscle hydration. hydromax ensures your muscles are hydrated enough to maximize performance and muscle contractions. in essence, hydromax® essentially turns your muscles into ultra absorbent sponges that soak up tons of extra water. this creates a state of “hyperhydration” in the muscle which leads to greater overall endurance in your workout and lays the groundwork for those water-based pumps we first mentioned.nitrosigineclinically validated at maximizing nitric oxide levels, nitrosigine is a novel ingredients designed to promote enhanced blood flow to your muscles. as one of the most potent and clinically proven nitric oxide boosting ingredients, it was a no brainer to include nitrosigine at the clinical dose of 1,500 mg. this leads to skin-splitting pumps and better nutrient delivery.coconut waterunique in the nitric oxide boosting game is the use of coconut water powder. coconut water is well known for its hydration benefits, and a properly hydrated muscle can contract better, which leads to more intense muscle pumps and contractions. coconut waters hydration benefits are also perfect to help mitigate cramping and can help normalize electrolyte balance.clinically validated n.o. boosting ingredients at massive doses are a staple in kraken pump: beetroot, hydromax glycerol, and nitrosigine offer unparalleled muscle pumps and increased vascularity. toss in a whopping 6 grams of l-citrulline and a super hydrated muscle cell from coconut water and kraken pump will make every workout a nitric oxide boosting and muscle swelling adventure.https://redsupps.co.uk/products/kraken-pump-non-stimulant-pre-workouthttps://cdn.shopify.com/s/files/1/2544/1734/products/kraken_pump_gummy_1_600x600_crop_center.png?v=1539632842SPARTA NUTRITION new 619625938995in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 32.99GBP shopify_619625938995_7776754597939Kraken pump non stimulant pre-workout  descriptionsparta nutrition brings you the ultimate caffeine and stimulant-free nitric oxide boosting pre workout: kraken pump. you haven’t experienced muscle pumps and vascularity until you have tried kraken pump. with large doses of l-citrulline, hydromax, and nitrosigine, nitric oxide levels are boosted and maintained to provide enhanced blood flow to your muscles. a more full muscle can experience skin tearing pumps and better nutrient utilization for lean muscle mass growth.kraken pump doesn’t stop at increasing no2: we at sparta nutrition went above and beyond by adding a very unique addition in coconut water. coconut water is very well known for its ability to hydrate cells at a higher rate. a more hydrated muscle can better effectively contract, allowing for intense muscle pumps. a more hydrated muscle can also better effectively utilise nutrients to grow lean muscle mass and allow you to train longer and harder. ingredientskraken pump features incredibly high doses of some of the most novel and clinically proven nitric oxide boosting ingredients todayl-citrullinetwo scoops of kraken pump provides 6 grams (6!) of one of the most popular muscle pump inducing ingredients, l-citrulline. your muscles will feel full and pumped to the max. l-citrulline is the go-to nitric oxide (n.o.) boosting ingredient on the market today for strong, dense pumps. the reason we’re such fans of l-citrulline is that it’s heads and tails better than l-arginine in terms of elevating n.o. levels.  this translates to bigger, badder, and better pumps during your workouts.hydromaxessential to a good workout is proper muscle hydration. hydromax ensures your muscles are hydrated enough to maximize performance and muscle contractions. in essence, hydromax® essentially turns your muscles into ultra absorbent sponges that soak up tons of extra water. this creates a state of “hyperhydration” in the muscle which leads to greater overall endurance in your workout and lays the groundwork for those water-based pumps we first mentioned.nitrosigineclinically validated at maximizing nitric oxide levels, nitrosigine is a novel ingredients designed to promote enhanced blood flow to your muscles. as one of the most potent and clinically proven nitric oxide boosting ingredients, it was a no brainer to include nitrosigine at the clinical dose of 1,500 mg. this leads to skin-splitting pumps and better nutrient delivery.coconut waterunique in the nitric oxide boosting game is the use of coconut water powder. coconut water is well known for its hydration benefits, and a properly hydrated muscle can contract better, which leads to more intense muscle pumps and contractions. coconut waters hydration benefits are also perfect to help mitigate cramping and can help normalize electrolyte balance.clinically validated n.o. boosting ingredients at massive doses are a staple in kraken pump: beetroot, hydromax glycerol, and nitrosigine offer unparalleled muscle pumps and increased vascularity. toss in a whopping 6 grams of l-citrulline and a super hydrated muscle cell from coconut water and kraken pump will make every workout a nitric oxide boosting and muscle swelling adventure.https://redsupps.co.uk/products/kraken-pump-non-stimulant-pre-workouthttps://cdn.shopify.com/s/files/1/2544/1734/products/kraken_pump_gummy_1_600x600_crop_center.png?v=1539632842SPARTA NUTRITION new 619625938995in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 32.99GBP shopify_619625938995_7776754630707Kraken pump non stimulant pre-workout  descriptionsparta nutrition brings you the ultimate caffeine and stimulant-free nitric oxide boosting pre workout: kraken pump. you haven’t experienced muscle pumps and vascularity until you have tried kraken pump. with large doses of l-citrulline, hydromax, and nitrosigine, nitric oxide levels are boosted and maintained to provide enhanced blood flow to your muscles. a more full muscle can experience skin tearing pumps and better nutrient utilization for lean muscle mass growth.kraken pump doesn’t stop at increasing no2: we at sparta nutrition went above and beyond by adding a very unique addition in coconut water. coconut water is very well known for its ability to hydrate cells at a higher rate. a more hydrated muscle can better effectively contract, allowing for intense muscle pumps. a more hydrated muscle can also better effectively utilise nutrients to grow lean muscle mass and allow you to train longer and harder. ingredientskraken pump features incredibly high doses of some of the most novel and clinically proven nitric oxide boosting ingredients todayl-citrullinetwo scoops of kraken pump provides 6 grams (6!) of one of the most popular muscle pump inducing ingredients, l-citrulline. your muscles will feel full and pumped to the max. l-citrulline is the go-to nitric oxide (n.o.) boosting ingredient on the market today for strong, dense pumps. the reason we’re such fans of l-citrulline is that it’s heads and tails better than l-arginine in terms of elevating n.o. levels.  this translates to bigger, badder, and better pumps during your workouts.hydromaxessential to a good workout is proper muscle hydration. hydromax ensures your muscles are hydrated enough to maximize performance and muscle contractions. in essence, hydromax® essentially turns your muscles into ultra absorbent sponges that soak up tons of extra water. this creates a state of “hyperhydration” in the muscle which leads to greater overall endurance in your workout and lays the groundwork for those water-based pumps we first mentioned.nitrosigineclinically validated at maximizing nitric oxide levels, nitrosigine is a novel ingredients designed to promote enhanced blood flow to your muscles. as one of the most potent and clinically proven nitric oxide boosting ingredients, it was a no brainer to include nitrosigine at the clinical dose of 1,500 mg. this leads to skin-splitting pumps and better nutrient delivery.coconut waterunique in the nitric oxide boosting game is the use of coconut water powder. coconut water is well known for its hydration benefits, and a properly hydrated muscle can contract better, which leads to more intense muscle pumps and contractions. coconut waters hydration benefits are also perfect to help mitigate cramping and can help normalize electrolyte balance.clinically validated n.o. boosting ingredients at massive doses are a staple in kraken pump: beetroot, hydromax glycerol, and nitrosigine offer unparalleled muscle pumps and increased vascularity. toss in a whopping 6 grams of l-citrulline and a super hydrated muscle cell from coconut water and kraken pump will make every workout a nitric oxide boosting and muscle swelling adventure.https://redsupps.co.uk/products/kraken-pump-non-stimulant-pre-workouthttps://cdn.shopify.com/s/files/1/2544/1734/products/kraken_pump_gummy_1_600x600_crop_center.png?v=1539632842SPARTA NUTRITION new 619625938995in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMuscle Pump Formula 32.99GBP shopify_1458926452787_13090982658099L-optizinc 30 mg  descriptionimmune supporthighly bioavailable formsupports enzyme functionwith coppernon gmoa dietary supplementvegetarian/vegankoshermineralsfamily owned since 1968gmp quality assuredl-optizinc is a form of zinc complexed with the amino acids methionine. research has demonstrated this product to be better absorbed and retained longer compared to several other forms of zinc tested. suggested usetake 1 capsule daily. other ingredientsrice flour, cellulose (capsule) and stearic acid (vegetable source).not manufactured with wheat, gluten, soy, milk, egg, fish, shellfish or tree nut ingredients. produced in a gmp facility that processes other ingredients containing these allergens.https://redsupps.co.uk/products/l-optizinc-30-mghttps://cdn.shopify.com/s/files/1/2544/1734/products/NOW_ZIINC1_600x600_crop_center.jpg?v=1539139727NOW FOODS new 1458926452787in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsEssential Mineral 9.99GBP shopify_737542471731_8791114219571Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114252339Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114285107Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114317875Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114350643Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114383411Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114416179Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114448947Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114481715Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114514483Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114547251Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114580019Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114612787Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114645555Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114678323Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114711091Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114743859Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114776627Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114809395Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114842163Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114874931Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114907699Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114940467Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_737542471731_8791114973235Limitless stack  descriptionpre-workout energy meets intra-workout energy. with kraken and hydra8 bcaa, your 45-minute workout just turned into a 90-minute workout. your muscles might hate us at first, but you’ll thank us later when you reach those goals you’ve been striving for. suggested use:kraken: take one-two serving (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/limitless-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/limitlessstack_820x_e7bdba6b-4cbe-4428-921e-bfe8f2e580d2_600x600_crop_center.jpg?v=1539139756SPARTA NUTRITION new 737542471731in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsLIMITLESS STACK 54.99GBP shopify_520083308595_6992906813491Loco benefitsexplosive strength †tunnel vision focus †off the wall energy †volumizing pumps †paving the way for the new class of pre-workout powders, loco® is truly a work of art. with over 17 grams of actives per full dose, utilizing only the finest sourced ingredients each in their respected doses of psychoactives, nootropics, muscle primers and our new micro-peptide technology (blox™) for true effectiveness, this top-shelf pre-workout super powder is bringing efficacy back to the industry.  a pre-workout connoisseur and pioneer driven by quality, it was only right to create a precise and potent pre-workout formula of ultra-premium caliber. delivering what the pre-workout genres lack, loco® is a one of a kind formula dosed according to each ingredient in their effective amount. †https://redsupps.co.uk/products/locohttps://cdn.shopify.com/s/files/1/2544/1734/products/2018-LOCO-MOCKUP_600x600_crop_center.jpg?v=1539139769MYOBLOX new 520083308595in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 37.99GBP shopify_520083308595_8709851054131Loco benefitsexplosive strength †tunnel vision focus †off the wall energy †volumizing pumps †paving the way for the new class of pre-workout powders, loco® is truly a work of art. with over 17 grams of actives per full dose, utilizing only the finest sourced ingredients each in their respected doses of psychoactives, nootropics, muscle primers and our new micro-peptide technology (blox™) for true effectiveness, this top-shelf pre-workout super powder is bringing efficacy back to the industry.  a pre-workout connoisseur and pioneer driven by quality, it was only right to create a precise and potent pre-workout formula of ultra-premium caliber. delivering what the pre-workout genres lack, loco® is a one of a kind formula dosed according to each ingredient in their effective amount. †https://redsupps.co.uk/products/locohttps://cdn.shopify.com/s/files/1/2544/1734/products/2018-LOCO-MOCKUP_600x600_crop_center.jpg?v=1539139769MYOBLOX new 520083308595in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 37.99GBP shopify_733953032243_8710516965427Loco cinco loco cinco by myobloxlimited edition - celebrating 5 years of loco - only available while supplies last.benefitsexplosive strengthtunnel vision focusoff the wall energyvolumizing pumpsflavor: sherbet margaritamyoblox creates yet another classic! the cinco is a limited edition that celebrates five years of the loco pre-workout powder, when it had originally came to the scene on cinco de mayo 2013. this limited formula contains a vast array of energy, focus, and performance optimizers to ensure an even stronger punch than the original loco! enjoy this ultra-premium formula in a delicious sherbet margarita flavor without the artificial dyes!https://redsupps.co.uk/products/loco-cincohttps://cdn.shopify.com/s/files/1/2544/1734/products/lococinco1x1_600x600_crop_center.jpg?v=1539139809MYOBLOX new 733953032243in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 39.00GBP shopify_619446632499_7776133480499Mania benefitstestosterone / gh support †lean muscle & strength †hydration & vo2 support †mitochondrial health †cortisol reduction †immune strength support †when formulating mania™, the objective was clear that this formula needed to be nothing short of superior. we have utilized the freshest quality materials from their natural respected climates to promote the most potent effects. elevating test levels to aphrodisiac effects, to the performance and cellular health benefits, mania™ is well equipped with proven and powerful ingredients to be more than just another test booster. † empower yourself™https://redsupps.co.uk/products/maniahttps://cdn.shopify.com/s/files/1/2544/1734/products/Mania_1024x_9bc12393-9aa6-4a78-b177-7e3d2d23c10a_600x600_crop_center.jpg?v=1539139923MYOBLOX new 619446632499in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsTestosterone Booster 47.99GBP shopify_675570090035_8238581874739Men's hardcore muscle stack stacks automatically discounted 10% or morewhat's included?only includes one chosen1 or brutal 4ce, not both!metha-quad extremegrowthhttps://redsupps.co.uk/products/mens-hardcore-muscle-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/male-muscle-hardcore-01_preview_1024x_04f9b6ae-bc99-4fbd-872d-7a6064b011b0_600x600_crop_center.png?v=1539139935Blackstone Labs new 675570090035in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMen's Hardcore Muscle Stack 125.00GBP shopify_675570090035_8238581907507Men's hardcore muscle stack stacks automatically discounted 10% or morewhat's included?only includes one chosen1 or brutal 4ce, not both!metha-quad extremegrowthhttps://redsupps.co.uk/products/mens-hardcore-muscle-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/male-muscle-hardcore-01_preview_1024x_04f9b6ae-bc99-4fbd-872d-7a6064b011b0_600x600_crop_center.png?v=1539139935Blackstone Labs new 675570090035in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMen's Hardcore Muscle Stack 125.00GBP shopify_551812431923_7270083330099Men's muscle building stack stacks automatically discounted 10% or morewhat's included?1 anogenin1 growth1 apex male1 epi-cat https://redsupps.co.uk/products/mens-muscle-building-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/male-muscle-natty_1024x_0a279b77-8f19-452c-8df9-2de6e2a7a26a_600x600_crop_center.png?v=1539139948Blackstone Labs new 551812431923in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMen's Muscle Building Stack 135.99GBP shopify_691178569779_8412881584179Men's muscle stack stacks automatically discounted 10% or morewhat's included?apex malerecomp rxhttps://redsupps.co.uk/products/mens-muscle-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/male-muscle_1024x_8f85c021-3fe4-4c70-bd31-0f45eb11dfe4_600x600_crop_center.png?v=1539139952Blackstone Labs new 691178569779in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsMen's Muscle Stack 73.99GBP shopify_1458839027763_13089559773235Mesomorph® competition series mesomorph® competition series preworkout supplementsupercharged energy formulaultimate preworkout complex with creatine nitrateunleash your true genetic potentialmuscle gains and enhanced athletic performancestrength, stamina and energy are they keys for any quality preworkout. aps nutrition’s mesomorph® does this and so much more. with its extreme energy igniting, vein blasting, and fatigue fighting power formula, mesomorph® is the new king of concentrated preworkout performance supplements. want more? mesomorph® uses focus and energy boosters to ensure that your workout and training reaches its maximum performance potential. this complete preworkout energy matrix is the only product on the market to deliver full clinical doses of its state of the art ingredients. mesomorph® has reviewed the research and compiled the data to introduce two of the new heavy hitter ingredients for unparalleled results with a new, scientifically-proven mind-blowing energy ingredient called “senegalia berlandieri”. this ingredient is often called the “ephedrine impostor” due to its amazing energy boosting properties, and this new trademarked ingredient will soon revolutionize the preworkout market. mesomorph® utilizes muscle pump inducing exclusive, premium ingredients like creatine nitrate, creatinol-o-phosphate, 4,000mg of beta alanine and pre-workout power house citrulline malate. according to a study conducted by the university of california, los angeles, creatine nitrate is 1000% more water soluble than either creatine monohydrate or other creatine derivatives. unmatched water solubility ensures better absorption and absolutely none of the traditional side effects of creatine supplementation. with smooth delivering, focus enhancing, muscle blasting active ingredients, mesomorph® contains up to 4 times more muscle-building, skin stretching, energy-igniting active ingredients over other leading brands. whether you are in training for a sport, bodybuilding competition, competitive weight lifting or just beginners in exercise, this dynamic product is a “must have”.   as with any nutritional supplement, competitive athletes should check with your regulatory body before using this product.https://redsupps.co.uk/products/mesomorph®-competition-serieshttps://cdn.shopify.com/s/files/1/2544/1734/products/Mesomorph__Green_Apple_Candy_SEN_500x500_1024x1024_1ed26725-f1e8-4525-b458-7e1fbc7ed449_600x600_crop_center.png?v=1539139958APS new 1458839027763in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 39.00GBP shopify_1458839027763_13089559838771Mesomorph® competition series mesomorph® competition series preworkout supplementsupercharged energy formulaultimate preworkout complex with creatine nitrateunleash your true genetic potentialmuscle gains and enhanced athletic performancestrength, stamina and energy are they keys for any quality preworkout. aps nutrition’s mesomorph® does this and so much more. with its extreme energy igniting, vein blasting, and fatigue fighting power formula, mesomorph® is the new king of concentrated preworkout performance supplements. want more? mesomorph® uses focus and energy boosters to ensure that your workout and training reaches its maximum performance potential. this complete preworkout energy matrix is the only product on the market to deliver full clinical doses of its state of the art ingredients. mesomorph® has reviewed the research and compiled the data to introduce two of the new heavy hitter ingredients for unparalleled results with a new, scientifically-proven mind-blowing energy ingredient called “senegalia berlandieri”. this ingredient is often called the “ephedrine impostor” due to its amazing energy boosting properties, and this new trademarked ingredient will soon revolutionize the preworkout market. mesomorph® utilizes muscle pump inducing exclusive, premium ingredients like creatine nitrate, creatinol-o-phosphate, 4,000mg of beta alanine and pre-workout power house citrulline malate. according to a study conducted by the university of california, los angeles, creatine nitrate is 1000% more water soluble than either creatine monohydrate or other creatine derivatives. unmatched water solubility ensures better absorption and absolutely none of the traditional side effects of creatine supplementation. with smooth delivering, focus enhancing, muscle blasting active ingredients, mesomorph® contains up to 4 times more muscle-building, skin stretching, energy-igniting active ingredients over other leading brands. whether you are in training for a sport, bodybuilding competition, competitive weight lifting or just beginners in exercise, this dynamic product is a “must have”.   as with any nutritional supplement, competitive athletes should check with your regulatory body before using this product.https://redsupps.co.uk/products/mesomorph®-competition-serieshttps://cdn.shopify.com/s/files/1/2544/1734/products/Mesomorph__Green_Apple_Candy_SEN_500x500_1024x1024_1ed26725-f1e8-4525-b458-7e1fbc7ed449_600x600_crop_center.png?v=1539139958APS new 1458839027763in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 39.00GBP shopify_1458839027763_13089559904307Mesomorph® competition series mesomorph® competition series preworkout supplementsupercharged energy formulaultimate preworkout complex with creatine nitrateunleash your true genetic potentialmuscle gains and enhanced athletic performancestrength, stamina and energy are they keys for any quality preworkout. aps nutrition’s mesomorph® does this and so much more. with its extreme energy igniting, vein blasting, and fatigue fighting power formula, mesomorph® is the new king of concentrated preworkout performance supplements. want more? mesomorph® uses focus and energy boosters to ensure that your workout and training reaches its maximum performance potential. this complete preworkout energy matrix is the only product on the market to deliver full clinical doses of its state of the art ingredients. mesomorph® has reviewed the research and compiled the data to introduce two of the new heavy hitter ingredients for unparalleled results with a new, scientifically-proven mind-blowing energy ingredient called “senegalia berlandieri”. this ingredient is often called the “ephedrine impostor” due to its amazing energy boosting properties, and this new trademarked ingredient will soon revolutionize the preworkout market. mesomorph® utilizes muscle pump inducing exclusive, premium ingredients like creatine nitrate, creatinol-o-phosphate, 4,000mg of beta alanine and pre-workout power house citrulline malate. according to a study conducted by the university of california, los angeles, creatine nitrate is 1000% more water soluble than either creatine monohydrate or other creatine derivatives. unmatched water solubility ensures better absorption and absolutely none of the traditional side effects of creatine supplementation. with smooth delivering, focus enhancing, muscle blasting active ingredients, mesomorph® contains up to 4 times more muscle-building, skin stretching, energy-igniting active ingredients over other leading brands. whether you are in training for a sport, bodybuilding competition, competitive weight lifting or just beginners in exercise, this dynamic product is a “must have”.   as with any nutritional supplement, competitive athletes should check with your regulatory body before using this product.https://redsupps.co.uk/products/mesomorph®-competition-serieshttps://cdn.shopify.com/s/files/1/2544/1734/products/Mesomorph__Green_Apple_Candy_SEN_500x500_1024x1024_1ed26725-f1e8-4525-b458-7e1fbc7ed449_600x600_crop_center.png?v=1539139958APS new 1458839027763in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 39.00GBP shopify_1458839027763_13089559937075Mesomorph® competition series mesomorph® competition series preworkout supplementsupercharged energy formulaultimate preworkout complex with creatine nitrateunleash your true genetic potentialmuscle gains and enhanced athletic performancestrength, stamina and energy are they keys for any quality preworkout. aps nutrition’s mesomorph® does this and so much more. with its extreme energy igniting, vein blasting, and fatigue fighting power formula, mesomorph® is the new king of concentrated preworkout performance supplements. want more? mesomorph® uses focus and energy boosters to ensure that your workout and training reaches its maximum performance potential. this complete preworkout energy matrix is the only product on the market to deliver full clinical doses of its state of the art ingredients. mesomorph® has reviewed the research and compiled the data to introduce two of the new heavy hitter ingredients for unparalleled results with a new, scientifically-proven mind-blowing energy ingredient called “senegalia berlandieri”. this ingredient is often called the “ephedrine impostor” due to its amazing energy boosting properties, and this new trademarked ingredient will soon revolutionize the preworkout market. mesomorph® utilizes muscle pump inducing exclusive, premium ingredients like creatine nitrate, creatinol-o-phosphate, 4,000mg of beta alanine and pre-workout power house citrulline malate. according to a study conducted by the university of california, los angeles, creatine nitrate is 1000% more water soluble than either creatine monohydrate or other creatine derivatives. unmatched water solubility ensures better absorption and absolutely none of the traditional side effects of creatine supplementation. with smooth delivering, focus enhancing, muscle blasting active ingredients, mesomorph® contains up to 4 times more muscle-building, skin stretching, energy-igniting active ingredients over other leading brands. whether you are in training for a sport, bodybuilding competition, competitive weight lifting or just beginners in exercise, this dynamic product is a “must have”.   as with any nutritional supplement, competitive athletes should check with your regulatory body before using this product.https://redsupps.co.uk/products/mesomorph®-competition-serieshttps://cdn.shopify.com/s/files/1/2544/1734/products/Mesomorph__Green_Apple_Candy_SEN_500x500_1024x1024_1ed26725-f1e8-4525-b458-7e1fbc7ed449_600x600_crop_center.png?v=1539139958APS new 1458839027763in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 39.00GBP shopify_1458839027763_13089560002611Mesomorph® competition series mesomorph® competition series preworkout supplementsupercharged energy formulaultimate preworkout complex with creatine nitrateunleash your true genetic potentialmuscle gains and enhanced athletic performancestrength, stamina and energy are they keys for any quality preworkout. aps nutrition’s mesomorph® does this and so much more. with its extreme energy igniting, vein blasting, and fatigue fighting power formula, mesomorph® is the new king of concentrated preworkout performance supplements. want more? mesomorph® uses focus and energy boosters to ensure that your workout and training reaches its maximum performance potential. this complete preworkout energy matrix is the only product on the market to deliver full clinical doses of its state of the art ingredients. mesomorph® has reviewed the research and compiled the data to introduce two of the new heavy hitter ingredients for unparalleled results with a new, scientifically-proven mind-blowing energy ingredient called “senegalia berlandieri”. this ingredient is often called the “ephedrine impostor” due to its amazing energy boosting properties, and this new trademarked ingredient will soon revolutionize the preworkout market. mesomorph® utilizes muscle pump inducing exclusive, premium ingredients like creatine nitrate, creatinol-o-phosphate, 4,000mg of beta alanine and pre-workout power house citrulline malate. according to a study conducted by the university of california, los angeles, creatine nitrate is 1000% more water soluble than either creatine monohydrate or other creatine derivatives. unmatched water solubility ensures better absorption and absolutely none of the traditional side effects of creatine supplementation. with smooth delivering, focus enhancing, muscle blasting active ingredients, mesomorph® contains up to 4 times more muscle-building, skin stretching, energy-igniting active ingredients over other leading brands. whether you are in training for a sport, bodybuilding competition, competitive weight lifting or just beginners in exercise, this dynamic product is a “must have”.   as with any nutritional supplement, competitive athletes should check with your regulatory body before using this product.https://redsupps.co.uk/products/mesomorph®-competition-serieshttps://cdn.shopify.com/s/files/1/2544/1734/products/Mesomorph__Green_Apple_Candy_SEN_500x500_1024x1024_1ed26725-f1e8-4525-b458-7e1fbc7ed449_600x600_crop_center.png?v=1539139958APS new 1458839027763in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 39.00GBP shopify_1458839027763_13089560068147Mesomorph® competition series mesomorph® competition series preworkout supplementsupercharged energy formulaultimate preworkout complex with creatine nitrateunleash your true genetic potentialmuscle gains and enhanced athletic performancestrength, stamina and energy are they keys for any quality preworkout. aps nutrition’s mesomorph® does this and so much more. with its extreme energy igniting, vein blasting, and fatigue fighting power formula, mesomorph® is the new king of concentrated preworkout performance supplements. want more? mesomorph® uses focus and energy boosters to ensure that your workout and training reaches its maximum performance potential. this complete preworkout energy matrix is the only product on the market to deliver full clinical doses of its state of the art ingredients. mesomorph® has reviewed the research and compiled the data to introduce two of the new heavy hitter ingredients for unparalleled results with a new, scientifically-proven mind-blowing energy ingredient called “senegalia berlandieri”. this ingredient is often called the “ephedrine impostor” due to its amazing energy boosting properties, and this new trademarked ingredient will soon revolutionize the preworkout market. mesomorph® utilizes muscle pump inducing exclusive, premium ingredients like creatine nitrate, creatinol-o-phosphate, 4,000mg of beta alanine and pre-workout power house citrulline malate. according to a study conducted by the university of california, los angeles, creatine nitrate is 1000% more water soluble than either creatine monohydrate or other creatine derivatives. unmatched water solubility ensures better absorption and absolutely none of the traditional side effects of creatine supplementation. with smooth delivering, focus enhancing, muscle blasting active ingredients, mesomorph® contains up to 4 times more muscle-building, skin stretching, energy-igniting active ingredients over other leading brands. whether you are in training for a sport, bodybuilding competition, competitive weight lifting or just beginners in exercise, this dynamic product is a “must have”.   as with any nutritional supplement, competitive athletes should check with your regulatory body before using this product.https://redsupps.co.uk/products/mesomorph®-competition-serieshttps://cdn.shopify.com/s/files/1/2544/1734/products/Mesomorph__Green_Apple_Candy_SEN_500x500_1024x1024_1ed26725-f1e8-4525-b458-7e1fbc7ed449_600x600_crop_center.png?v=1539139958APS new 1458839027763in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 39.00GBP shopify_1458839027763_13089560100915Mesomorph® competition series mesomorph® competition series preworkout supplementsupercharged energy formulaultimate preworkout complex with creatine nitrateunleash your true genetic potentialmuscle gains and enhanced athletic performancestrength, stamina and energy are they keys for any quality preworkout. aps nutrition’s mesomorph® does this and so much more. with its extreme energy igniting, vein blasting, and fatigue fighting power formula, mesomorph® is the new king of concentrated preworkout performance supplements. want more? mesomorph® uses focus and energy boosters to ensure that your workout and training reaches its maximum performance potential. this complete preworkout energy matrix is the only product on the market to deliver full clinical doses of its state of the art ingredients. mesomorph® has reviewed the research and compiled the data to introduce two of the new heavy hitter ingredients for unparalleled results with a new, scientifically-proven mind-blowing energy ingredient called “senegalia berlandieri”. this ingredient is often called the “ephedrine impostor” due to its amazing energy boosting properties, and this new trademarked ingredient will soon revolutionize the preworkout market. mesomorph® utilizes muscle pump inducing exclusive, premium ingredients like creatine nitrate, creatinol-o-phosphate, 4,000mg of beta alanine and pre-workout power house citrulline malate. according to a study conducted by the university of california, los angeles, creatine nitrate is 1000% more water soluble than either creatine monohydrate or other creatine derivatives. unmatched water solubility ensures better absorption and absolutely none of the traditional side effects of creatine supplementation. with smooth delivering, focus enhancing, muscle blasting active ingredients, mesomorph® contains up to 4 times more muscle-building, skin stretching, energy-igniting active ingredients over other leading brands. whether you are in training for a sport, bodybuilding competition, competitive weight lifting or just beginners in exercise, this dynamic product is a “must have”.   as with any nutritional supplement, competitive athletes should check with your regulatory body before using this product.https://redsupps.co.uk/products/mesomorph®-competition-serieshttps://cdn.shopify.com/s/files/1/2544/1734/products/Mesomorph__Green_Apple_Candy_SEN_500x500_1024x1024_1ed26725-f1e8-4525-b458-7e1fbc7ed449_600x600_crop_center.png?v=1539139958APS new 1458839027763in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 39.00GBP shopify_1458839027763_13089560166451Mesomorph® competition series mesomorph® competition series preworkout supplementsupercharged energy formulaultimate preworkout complex with creatine nitrateunleash your true genetic potentialmuscle gains and enhanced athletic performancestrength, stamina and energy are they keys for any quality preworkout. aps nutrition’s mesomorph® does this and so much more. with its extreme energy igniting, vein blasting, and fatigue fighting power formula, mesomorph® is the new king of concentrated preworkout performance supplements. want more? mesomorph® uses focus and energy boosters to ensure that your workout and training reaches its maximum performance potential. this complete preworkout energy matrix is the only product on the market to deliver full clinical doses of its state of the art ingredients. mesomorph® has reviewed the research and compiled the data to introduce two of the new heavy hitter ingredients for unparalleled results with a new, scientifically-proven mind-blowing energy ingredient called “senegalia berlandieri”. this ingredient is often called the “ephedrine impostor” due to its amazing energy boosting properties, and this new trademarked ingredient will soon revolutionize the preworkout market. mesomorph® utilizes muscle pump inducing exclusive, premium ingredients like creatine nitrate, creatinol-o-phosphate, 4,000mg of beta alanine and pre-workout power house citrulline malate. according to a study conducted by the university of california, los angeles, creatine nitrate is 1000% more water soluble than either creatine monohydrate or other creatine derivatives. unmatched water solubility ensures better absorption and absolutely none of the traditional side effects of creatine supplementation. with smooth delivering, focus enhancing, muscle blasting active ingredients, mesomorph® contains up to 4 times more muscle-building, skin stretching, energy-igniting active ingredients over other leading brands. whether you are in training for a sport, bodybuilding competition, competitive weight lifting or just beginners in exercise, this dynamic product is a “must have”.   as with any nutritional supplement, competitive athletes should check with your regulatory body before using this product.https://redsupps.co.uk/products/mesomorph®-competition-serieshttps://cdn.shopify.com/s/files/1/2544/1734/products/Mesomorph__Green_Apple_Candy_SEN_500x500_1024x1024_1ed26725-f1e8-4525-b458-7e1fbc7ed449_600x600_crop_center.png?v=1539139958APS new 1458839027763in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout 39.00GBP shopify_369632837669_4714159177765Metha-quad extreme metha-quad extremepotent phultimate mass stack base descriptionrapid increases in size. greater strength and power output. pumps and vascularity that would make arnold jealous. no, this isn’t some dream you’re having...these are the real-world results attainable with the latest groundbreaking muscle-building supplement from blackstone labs.metha-quad extreme is the most powerful designer prohormone stack ever created. it delivers the immediate lean gains you’re looking for along with the density and muscle maturity of a seasoned. metha-quad extreme contains four of the most effective muscle-building, testosterone-boosting compounds on earth all enveloped in cyclosome delivery technology to provide maximum uptake and utilization by the body. metha-quad extreme puts your muscle building capabilities into overdrive, forcing your body to get bigger, stronger, and faster every day. directionsas a dietary supplement, take one (1) tablet within 1 hour of training. do not exceed two (2) tablets daily.https://redsupps.co.uk/products/blackstone-labs-methaquad-extremehttps://cdn.shopify.com/s/files/1/2544/1734/products/methaquad_600x600_crop_center.png?v=1539140032Blackstone Labs new 369632837669in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProhormone Stack 59.99GBP shopify_1458931728435_13091070804019Mk-7, vitamin k-2 100 mcg descriptionsupports bone healthpromotes proper calcium handlingnon-gmoa dietary supplementvegetarian - vegankoshervitaminsfamily owned since 1968gmp quality assuredvitamin k is well known for its role in the synthesis of a number of blood coagulation factors. during recent years however, vitamin k2 and its dependent proteins have been found to play a central role in whole-body calcium metabolism. these vitamin k2-dependent proteins are now known to be essential for normal bone mineralization, as well as for other critical functions unrelated to coagulation. now mk-7 contains a highly biologically active form of vitamin k2 derived from non-gmo natto, a traditional japanese fermented soyfood. suggested usetake 1 capsule daily with a deal. other ingredientsrice flour, cellulose (capsule) and silica.contains soy (non-gmo).not manufactured with wheat, gluten, milk, egg, fish, shellfish or tree nut ingredients. produced in a gmp facility that processes other ingredients containing these allergens.https://redsupps.co.uk/products/mk-7-vitamin-k-2-100-mcghttps://cdn.shopify.com/s/files/1/2544/1734/products/mk-7_600x600_crop_center.jpg?v=1539140041NOW FOODS new 1458931728435in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsVitamin K2 15.99GBP shopify_587764662323_7562601955379Non-caffeinated protein peanut spread 340g descriptionwhat is better than a fantastic source of protein, blend, quick and a variety of awesome flavours? nothing really…. which is why sinister labs angry mills peanut butter blend is top.  this unique peanut blend contains high quality proteins and is a fantastic energy source to get you through your day! as an athlete if you’re on the go and require a delicious and quick meal packed with protein then this spread is for you! power yourself through those lazy days and acquire protein easier than ever!for the athletes who desire fantastic taste and high-quality macro-nutrients then this is for you!  https://redsupps.co.uk/products/vicious-vanilla-powder-caffeinatedhttps://cdn.shopify.com/s/files/1/2544/1734/products/12oz-Chocolate-Chaos-Non-Caffeinated_1024x1024_a27b6c0e-6874-49de-afcc-884bfd548ed6_600x600_crop_center.jpg?v=1539140047Sinister Labs new 587764662323in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPeanut Powder 11.99GBP shopify_587764662323_7565338214451Non-caffeinated protein peanut spread 340g descriptionwhat is better than a fantastic source of protein, blend, quick and a variety of awesome flavours? nothing really…. which is why sinister labs angry mills peanut butter blend is top.  this unique peanut blend contains high quality proteins and is a fantastic energy source to get you through your day! as an athlete if you’re on the go and require a delicious and quick meal packed with protein then this spread is for you! power yourself through those lazy days and acquire protein easier than ever!for the athletes who desire fantastic taste and high-quality macro-nutrients then this is for you!  https://redsupps.co.uk/products/vicious-vanilla-powder-caffeinatedhttps://cdn.shopify.com/s/files/1/2544/1734/products/12oz-Chocolate-Chaos-Non-Caffeinated_1024x1024_a27b6c0e-6874-49de-afcc-884bfd548ed6_600x600_crop_center.jpg?v=1539140047Sinister Labs new 587764662323in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPeanut Powder 11.99GBP shopify_587764662323_7565338247219Non-caffeinated protein peanut spread 340g descriptionwhat is better than a fantastic source of protein, blend, quick and a variety of awesome flavours? nothing really…. which is why sinister labs angry mills peanut butter blend is top.  this unique peanut blend contains high quality proteins and is a fantastic energy source to get you through your day! as an athlete if you’re on the go and require a delicious and quick meal packed with protein then this spread is for you! power yourself through those lazy days and acquire protein easier than ever!for the athletes who desire fantastic taste and high-quality macro-nutrients then this is for you!  https://redsupps.co.uk/products/vicious-vanilla-powder-caffeinatedhttps://cdn.shopify.com/s/files/1/2544/1734/products/12oz-Chocolate-Chaos-Non-Caffeinated_1024x1024_a27b6c0e-6874-49de-afcc-884bfd548ed6_600x600_crop_center.jpg?v=1539140047Sinister Labs new 587764662323in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPeanut Powder 11.99GBP shopify_587764662323_7565338279987Non-caffeinated protein peanut spread 340g descriptionwhat is better than a fantastic source of protein, blend, quick and a variety of awesome flavours? nothing really…. which is why sinister labs angry mills peanut butter blend is top.  this unique peanut blend contains high quality proteins and is a fantastic energy source to get you through your day! as an athlete if you’re on the go and require a delicious and quick meal packed with protein then this spread is for you! power yourself through those lazy days and acquire protein easier than ever!for the athletes who desire fantastic taste and high-quality macro-nutrients then this is for you!  https://redsupps.co.uk/products/vicious-vanilla-powder-caffeinatedhttps://cdn.shopify.com/s/files/1/2544/1734/products/12oz-Chocolate-Chaos-Non-Caffeinated_1024x1024_a27b6c0e-6874-49de-afcc-884bfd548ed6_600x600_crop_center.jpg?v=1539140047Sinister Labs new 587764662323in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPeanut Powder 11.99GBP shopify_587764662323_7565338312755Non-caffeinated protein peanut spread 340g descriptionwhat is better than a fantastic source of protein, blend, quick and a variety of awesome flavours? nothing really…. which is why sinister labs angry mills peanut butter blend is top.  this unique peanut blend contains high quality proteins and is a fantastic energy source to get you through your day! as an athlete if you’re on the go and require a delicious and quick meal packed with protein then this spread is for you! power yourself through those lazy days and acquire protein easier than ever!for the athletes who desire fantastic taste and high-quality macro-nutrients then this is for you!  https://redsupps.co.uk/products/vicious-vanilla-powder-caffeinatedhttps://cdn.shopify.com/s/files/1/2544/1734/products/12oz-Chocolate-Chaos-Non-Caffeinated_1024x1024_a27b6c0e-6874-49de-afcc-884bfd548ed6_600x600_crop_center.jpg?v=1539140047Sinister Labs new 587764662323in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPeanut Powder 11.99GBP shopify_369635688485_5034246864933Orthobolic benefitshelps increase joint mobilitysupports joint strength and flexibility descriptiona life spent pushing your body to the absolute extreme comes with incredible gains, but also some pretty nasty injuries too. whether you’re a competitive bodybuilder or high-level sports athlete, taxing your body relentlessly day in and day out wreaks havoc on your joints and connective tissue. this life of hard training demands a hardcore recovery supplement. one that restores joint health, flexibility, and mobility to the days of your youth.orthobolic is the athlete’s joint health formula. it “cleans up” joints that have been whittled down by years of stress. no more creaky knees, achy backs, or bum shoulders. orthobolic allows you to go harder, yet feel stronger, by providing the essential repair and support your joints demand on a daily basis. move better, feel better with orthobolic. ingredientspalmitoylethanolamide (200mg) limits histamines, inflammatory cytokines, and reactive oxygen species (ros) by reducing the activation of mast cells. additional research notes that palmitoylethanolamide it can bind to cox-2 (just like ibuprofen), which can help mediate pain and inflammation.cissus quadrangularis (350mg) stimulates the metabolism and uptake of calcium by osteoblasts (bone cells) which increases fracture healing. cissus quadrangularis has also been shown to reduce healing time, decrease joint discomfort, improve functionality, and increase collagen synthesis in osteoblasts.boswellia serrata (150mg) functions as a lipoxygenase-5 (lox-5) inhibitor, blocking the conversion of fatty acids into leukotrienes like histamines or prostaglandins. boswellia contains akba (3-o-acetyl-11-keto-boswellic acid) which has been shown to reduce joint discomfort and joint stiffness in as little as 7 days.curcumin (150mg) reduces expression of proinflammatory cytokines such as il-6, tnf-alpha, nf-kappab, cox-2 and lox-5, which can destroy joint cartilage. research shows this compound can decrease swollen joints and tenderness as well as increase anti-inflammatory activity by enhancing free radical scavenging. uc-ii (40mg) aids the body's natural process of removing damaged collagen/tissue and repairing damaged areas. containing undenatured type ii collagen, uc-ii also reduces perceived pain levels and the amount of otc pain medication used by patients in a clinical study.bioperine (10mg) has been shown to increase bioavailability of curcumin by 2000% as well as enhance the absorption of numerous other compounds. bioperine maximizes the uptake and efficacy of all the other joint support ingredients in orthobolic for superior joint health and function. instructionsas a dietary supplement, take two (2) capsules with water once daily. do not exceed one (1) capsule daily.https://redsupps.co.uk/products/blackstone-labs-orthobolichttps://cdn.shopify.com/s/files/1/2544/1734/products/orthobolic_600x600_crop_center.png?v=1539140092Blackstone Labs new 369635688485in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsJoint Support 29.99GBP shopify_587986206771_7564904103987Panic pancakes 345g panic pancakes™ buttermilk blaze an american classic just got better! panic pancakes ™ buttermilk pancakes are the best way to start your mornings! with no artificial flavours, preservatives or added sugars, and 20g of protein per serving there is no doubt this will become part of your daily routine. just add water, cook, and top off with your favourite fruits, syrup, and angry mills™ spreads and powders. panic pancakes™ chocolate rage chocolate lovers will fall in love with our panic pancakes ™ chocolate rage baking flour and pancake mix! treat yourself to some chocolate pancakes, waffles, or pastries…the options are endless! panic pancakes™ offers 20g of protein per serving and has no artificial flavours, preservatives or added sugars and it is very versatile. combine with our angry mills caffeinated nut spreads and peanut powders for an extra kick of energy to your day! panic pancakes™ banana blitz panic pancakes ™ banana blitz baking flour offers a natural boost of potassium and provides 20g of protein per serving! our banana pancakes have the right amount of sweetness that will please any crowd. simply add water and cook! combine with your favourite breakfast dishes such as scrambled eggs and bacon for a delicious meal! all panic pancakes have 20g protein per serve, no added sugar and are between 200-210 calories per serve.https://redsupps.co.uk/products/panic-pancakeshttps://cdn.shopify.com/s/files/1/2544/1734/products/BANANA_BLITZ_1024x1024_63f82696-c344-4ab6-acbf-b1643433e6f4_600x600_crop_center.jpg?v=1539140112Sinister Labs new 587986206771in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Pancakes 9.99GBP shopify_587986206771_7564904136755Panic pancakes 345g panic pancakes™ buttermilk blaze an american classic just got better! panic pancakes ™ buttermilk pancakes are the best way to start your mornings! with no artificial flavours, preservatives or added sugars, and 20g of protein per serving there is no doubt this will become part of your daily routine. just add water, cook, and top off with your favourite fruits, syrup, and angry mills™ spreads and powders. panic pancakes™ chocolate rage chocolate lovers will fall in love with our panic pancakes ™ chocolate rage baking flour and pancake mix! treat yourself to some chocolate pancakes, waffles, or pastries…the options are endless! panic pancakes™ offers 20g of protein per serving and has no artificial flavours, preservatives or added sugars and it is very versatile. combine with our angry mills caffeinated nut spreads and peanut powders for an extra kick of energy to your day! panic pancakes™ banana blitz panic pancakes ™ banana blitz baking flour offers a natural boost of potassium and provides 20g of protein per serving! our banana pancakes have the right amount of sweetness that will please any crowd. simply add water and cook! combine with your favourite breakfast dishes such as scrambled eggs and bacon for a delicious meal! all panic pancakes have 20g protein per serve, no added sugar and are between 200-210 calories per serve.https://redsupps.co.uk/products/panic-pancakeshttps://cdn.shopify.com/s/files/1/2544/1734/products/BANANA_BLITZ_1024x1024_63f82696-c344-4ab6-acbf-b1643433e6f4_600x600_crop_center.jpg?v=1539140112Sinister Labs new 587986206771in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Pancakes 9.99GBP shopify_587986206771_7564904169523Panic pancakes 345g panic pancakes™ buttermilk blaze an american classic just got better! panic pancakes ™ buttermilk pancakes are the best way to start your mornings! with no artificial flavours, preservatives or added sugars, and 20g of protein per serving there is no doubt this will become part of your daily routine. just add water, cook, and top off with your favourite fruits, syrup, and angry mills™ spreads and powders. panic pancakes™ chocolate rage chocolate lovers will fall in love with our panic pancakes ™ chocolate rage baking flour and pancake mix! treat yourself to some chocolate pancakes, waffles, or pastries…the options are endless! panic pancakes™ offers 20g of protein per serving and has no artificial flavours, preservatives or added sugars and it is very versatile. combine with our angry mills caffeinated nut spreads and peanut powders for an extra kick of energy to your day! panic pancakes™ banana blitz panic pancakes ™ banana blitz baking flour offers a natural boost of potassium and provides 20g of protein per serving! our banana pancakes have the right amount of sweetness that will please any crowd. simply add water and cook! combine with your favourite breakfast dishes such as scrambled eggs and bacon for a delicious meal! all panic pancakes have 20g protein per serve, no added sugar and are between 200-210 calories per serve.https://redsupps.co.uk/products/panic-pancakeshttps://cdn.shopify.com/s/files/1/2544/1734/products/BANANA_BLITZ_1024x1024_63f82696-c344-4ab6-acbf-b1643433e6f4_600x600_crop_center.jpg?v=1539140112Sinister Labs new 587986206771in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Pancakes 9.99GBP shopify_1450038460467_12980391772211Panic pancakes™ pancake syrup - maple madness descriptiona healthier take on an american classic.sinister labs panic pancakes pancake syrup is the sugar free, zero calorie sweetener you’ve been looking for to complement your meals and treats. our syrup combines the classic sweet flavor that you love and crave. it’s perfect for topping pancakes, waffles!  add the sweet maple flavor to your favorite baked goods, yogurt, ice cream, and marinades with sinister labs panic pancakes pancake syrup.one serving of panic pancakes™ pancake syrup is guilt free of:sugar freezero caloriesno fatgluten freehttps://redsupps.co.uk/products/panic-pancakes™-pancake-syrup-maple-madnesshttps://cdn.shopify.com/s/files/1/2544/1734/products/PANIC_PANCAKES_SYRUP_MAPLE_MADNESS_1024x1024_63e5e5fe-170a-45fe-b42d-3b18db5c8923_600x600_crop_center.jpg?v=1539140126Sinister Labs new 1450038460467in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPancake Syrup 3.99GBP shopify_473670746149_5237650849829Paraburn  benefitsintense energypoison's fat dead descriptionthe problem with virtually all fat burners these days is that they’re nothing but a mish-mash of stimulants that do little in the way of actual fat burning. a serving of some mass-market fat loss supplement is more prone to give you jitters or a nasty crash than actually enhance your weight loss efforts.that’s where cobra 6p differs. this revolutionary fat burner uses proven ingredients that burn fat, suppress appetite, and increase energy expenditure without a litany of strange, unproven stimulants. each serving provides a modest dose of caffeine alongside research-backed non-stimulant fat reducers, yielding a formula that helps you drop fat faster than ever! ingredientscaffeine anhydrous (250mg) caffeine provides the foundation of all effective fat burners. it energizes the cns, enhancing energy, mood, and alertness -- all of which suffer during dieting. furthermore, caffeine also helps suppress appetite and stimulate lipolysis. cobra 6p includes an extremely appropriate 250mg per capsule of caffeine, enough to keep you upbeat and alert without making you feel jittery or overly-stimmed.achyranthes aspera (100mg) also known as “devil’s horsewhip, this powerful ayurvedic herb offers a number of benefits to those seeking to drop fat fast. first achyranthes aspera enhances thyroid function, increasing metabolic rate and calorie burn each day. it also reduces blood sugar levels and decreases appetite, and some research notes it may prevent some carbohydrate and fat digestion.theobromine (50mg) is a xanthine-like molecule similar to caffeine that stimulates the cns but not as aggressively as caffeine. theobromine provides smooth, long-lasting energy and helps prevent any crash associated with caffeine use. it also improves insulin sensitivity, which helps avoid the peaks and valleys of blood sugar spikes, which can induce bouts of ravenous hunger.capsaicin (30mg) the pungent alkaloid present in chile peppers that gives them their heat. capsaicin has been well documented to increase energy expenditure, enhance fat burning, and inhibit fat accumulation. don’t be surprised if you feel the burn with this ingredient!6-paradol (30mg) found in ginger and grains of paradise, 6-paradol is a pungent aromatic that’s an extremely powerful non-stimulant fat burning supplement. much like capsaicin, 6-paradol increases thermogenesis via activation of brown adipose tissue, resulting in greater energy expenditure. but that’s not all, 6-paradol also reduces blood sugar and decreases visceral fat making it one of the top researched products for anti-fat by scientists today.3,3-diiodothyronine (100mcg) t3 is a well-known thyroid activator but is known to have some pretty nasty side effects. cobra 6p utilizes 3,3-diiodothyronine (t2), which is similar to t3, but won’t lead to permanent thyroid shutdown like t3 supplementation will. t2 converts into t3, giving you the metabolism boosting benefits t3 supplementation but without the inevitable shutdown that occurs with rampant t3 use. the end results is better thyroid function, greater calorie burning, and ultimately, faster fat loss. instructionsas a dietary supplement, take one (1) to two (2) capsules up to two (2) times per day 20 minutes before a meal. do not exceed four (4) capsules per day.https://redsupps.co.uk/products/cobra-6p-60capshttps://cdn.shopify.com/s/files/1/2544/1734/products/paraburn_600x600_crop_center.png?v=1539140131Blackstone Labs new 473670746149in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsFat Burner 29.00GBP shopify_551829798963_7270296944691Pct plus stack stacks automatically discounted 10% or morewhat's included?apex malepctvhttps://redsupps.co.uk/products/ultimate-pct-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/ultimate-pct_1024x_0c28e0f9-23af-4ea4-9c5d-3cb9cb9fdfeb_600x600_crop_center.png?v=1539140139Blackstone Labs new 551829798963in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsUltimate PCT Stack 76.99GBP shopify_369642012709_4714184704037Pct v promotes lean muscle gainboosts testosterone and reduces estrogen descriptionaggressive supplement cycles can bring the biggest gains you’ve ever witnessed. in just a few weeks time, you can amass size and strength that would normally require years of intense daily training. as quick as those gains came, that’s how quickly they can go, along with your testosterone production if you don’t follow proper post cycle therapy.to preserve your hard-earned gains and restore hormonal homeostasis, blackstone labs has created pct v -- the ultimate post cycle therapy supplement designed to protect your body, prevent testosterone suppression, and facilitate your transition off cycle. with pct v, there’s no need for any other post cycle therapy supplement. pct v contains everything you need for comprehensive coverage and protection, ensuring you come off cycle better (and healthier) than ever. plus, pct v can can even be used by natural competitors looking for an anabolic edge! ingredientstribulus terrestris (250mg) increases production of luteinizing hormone (lh) which supports natural testosterone production. tribulus also helps reduce stress and cortisol, which is incredibly catabolic and a known testosterone killer.n-acetyl cysteine (125mg) increases the body’s production of glutathione, a powerful antioxidant that supports cell’s ability to fight damage from reactive oxygen species (ros). research also notes n-acetyl cysteine (nac) is an extremely effective liver protectant, which is essential during and after a cycle.arimistane (37.5mg) keeps excess estrogen levels in check when coming off cycle by acting as a suicidal aromatase inhibitor (ai). excess estrogen leads to water and fat retention, mood swings, lack of sex drive and low energy. arimistane maximizes natural testosterone production ensuring your gains remain long after your cycle is complete.5-alpha-hydroxy laxogenin (25mg) has been shown in research to increase muscle protein synthesis by 200%! this all-natural plant steroid also exerts anti-catabolic effects by increasing nitrogen retention and blunting cortisol. laxogenin allows you to keep making massive gains even when your off cycle. directionsas a dietary supplement, take one (1) capsule in the a.m. and one (1) capsule in the p.m. do not exceed two (2) capsules daily.https://redsupps.co.uk/products/new-blackstone-labs-pct-v-60caps-post-cycle-therapy-uphold-mend-raisehttps://cdn.shopify.com/s/files/1/2544/1734/products/pctV_600x600_crop_center.png?v=1539140141Blackstone Labs new 369642012709in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPCT Support 42.99GBP shopify_737543684147_8791156064307Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156097075Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156129843Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156162611Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156195379Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156228147Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156260915Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156293683Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156326451Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156359219Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156391987Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156424755Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156457523Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156490291Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156523059Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156555827Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156588595Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156621363Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156654131Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156686899Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156719667Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156752435Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156785203Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156817971Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156850739Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156883507Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156916275Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156949043Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791156981811Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157014579Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157047347Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157080115Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157112883Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157145651Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157178419Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157211187Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157243955Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157276723Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157309491Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157342259Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157375027Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157407795Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157440563Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157473331Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157506099Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157538867Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157571635Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157604403Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157637171Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157669939Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157702707Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157735475Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157768243Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157801011Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157833779Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157866547Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157899315Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157932083Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157964851Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791157997619Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158030387Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158063155Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158095923Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158128691Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158161459Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158194227Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158226995Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158259763Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158292531Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158325299Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158358067Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158390835Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158423603Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158456371Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158489139Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158521907Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158554675Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158587443Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158620211Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158652979Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158685747Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158718515Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158751283Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158784051Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158816819Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158849587Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158882355Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158915123Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158947891Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791158980659Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791159013427Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791159046195Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791159078963Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791159111731Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791159144499Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_737543684147_8791159177267Performance stack  descriptiondominate your workout and sustain your endurance with the performance stack. while kraken and kraken pump prime you for the workout of your life, hydra8 bcaa will keep your endurance and training intensity through the roof with clinically crafted dose of caffeine and teacrine. the post workout crash is a thing of the past. suggested usekraken: take one-two serving (1-2 scoops) prior to working out.kraken pump: take one-two servings (1-2 scoops) prior to working out.hydra8 bcaa: take one serving with 12-16oz of water while you workouthttps://redsupps.co.uk/products/performance-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/performancestack_820x_eb7234ad-3f5a-4586-93ab-6496a6cdb3ef_600x600_crop_center.jpg?v=1539140190SPARTA NUTRITION new 737543684147in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPERFORMANCE STACK 84.99GBP shopify_675583885363_12933944639539Pre-workout stack stacks automatically discounted 10% or morewhat's included?dust v2hype https://redsupps.co.uk/products/pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/preworkout_1024x_d55dd3d3-6545-4ea4-8015-7b9b3153cc99_600x600_crop_center.png?v=1537985648Blackstone Labs new 675583885363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 52.99GBP shopify_675583885363_12933966594099Pre-workout stack stacks automatically discounted 10% or morewhat's included?dust v2hype https://redsupps.co.uk/products/pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/preworkout_1024x_d55dd3d3-6545-4ea4-8015-7b9b3153cc99_600x600_crop_center.png?v=1537985648Blackstone Labs new 675583885363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 52.99GBP shopify_675583885363_12933966626867Pre-workout stack stacks automatically discounted 10% or morewhat's included?dust v2hype https://redsupps.co.uk/products/pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/preworkout_1024x_d55dd3d3-6545-4ea4-8015-7b9b3153cc99_600x600_crop_center.png?v=1537985648Blackstone Labs new 675583885363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 52.99GBP shopify_675583885363_12933966659635Pre-workout stack stacks automatically discounted 10% or morewhat's included?dust v2hype https://redsupps.co.uk/products/pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/preworkout_1024x_d55dd3d3-6545-4ea4-8015-7b9b3153cc99_600x600_crop_center.png?v=1537985648Blackstone Labs new 675583885363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 52.99GBP shopify_675583885363_12933966692403Pre-workout stack stacks automatically discounted 10% or morewhat's included?dust v2hype https://redsupps.co.uk/products/pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/preworkout_1024x_d55dd3d3-6545-4ea4-8015-7b9b3153cc99_600x600_crop_center.png?v=1537985648Blackstone Labs new 675583885363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 52.99GBP shopify_675583885363_12933966725171Pre-workout stack stacks automatically discounted 10% or morewhat's included?dust v2hype https://redsupps.co.uk/products/pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/preworkout_1024x_d55dd3d3-6545-4ea4-8015-7b9b3153cc99_600x600_crop_center.png?v=1537985648Blackstone Labs new 675583885363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 52.99GBP shopify_675583885363_12933966757939Pre-workout stack stacks automatically discounted 10% or morewhat's included?dust v2hype https://redsupps.co.uk/products/pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/preworkout_1024x_d55dd3d3-6545-4ea4-8015-7b9b3153cc99_600x600_crop_center.png?v=1537985648Blackstone Labs new 675583885363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 52.99GBP shopify_675583885363_12933966790707Pre-workout stack stacks automatically discounted 10% or morewhat's included?dust v2hype https://redsupps.co.uk/products/pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/preworkout_1024x_d55dd3d3-6545-4ea4-8015-7b9b3153cc99_600x600_crop_center.png?v=1537985648Blackstone Labs new 675583885363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 52.99GBP shopify_675583885363_12933966823475Pre-workout stack stacks automatically discounted 10% or morewhat's included?dust v2hype https://redsupps.co.uk/products/pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/preworkout_1024x_d55dd3d3-6545-4ea4-8015-7b9b3153cc99_600x600_crop_center.png?v=1537985648Blackstone Labs new 675583885363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 52.99GBP shopify_675583885363_12933966856243Pre-workout stack stacks automatically discounted 10% or morewhat's included?dust v2hype https://redsupps.co.uk/products/pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/preworkout_1024x_d55dd3d3-6545-4ea4-8015-7b9b3153cc99_600x600_crop_center.png?v=1537985648Blackstone Labs new 675583885363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 52.99GBP shopify_675583885363_12933966889011Pre-workout stack stacks automatically discounted 10% or morewhat's included?dust v2hype https://redsupps.co.uk/products/pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/preworkout_1024x_d55dd3d3-6545-4ea4-8015-7b9b3153cc99_600x600_crop_center.png?v=1537985648Blackstone Labs new 675583885363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 52.99GBP shopify_675583885363_12933966921779Pre-workout stack stacks automatically discounted 10% or morewhat's included?dust v2hype https://redsupps.co.uk/products/pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/preworkout_1024x_d55dd3d3-6545-4ea4-8015-7b9b3153cc99_600x600_crop_center.png?v=1537985648Blackstone Labs new 675583885363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 52.99GBP shopify_675583885363_12933966954547Pre-workout stack stacks automatically discounted 10% or morewhat's included?dust v2hype https://redsupps.co.uk/products/pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/preworkout_1024x_d55dd3d3-6545-4ea4-8015-7b9b3153cc99_600x600_crop_center.png?v=1537985648Blackstone Labs new 675583885363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 52.99GBP shopify_675583885363_12933966987315Pre-workout stack stacks automatically discounted 10% or morewhat's included?dust v2hype https://redsupps.co.uk/products/pre-workout-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/preworkout_1024x_d55dd3d3-6545-4ea4-8015-7b9b3153cc99_600x600_crop_center.png?v=1537985648Blackstone Labs new 675583885363in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPre-Workout Stack 52.99GBP shopify_1417820340275_12821987950643Pre-workout stack stacks automatically discounted 10% or morewhat's included?blolocohttps://redsupps.co.uk/products/pre-workout-stack-1https://cdn.shopify.com/s/files/1/2544/1734/products/LOCO-BLO-STACK_1024x_b84e6cc3-1828-4870-9fad-85b70b8fd6c9_600x600_crop_center.jpg?v=1539140221MYOBLOX new 1417820340275in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPRE-WORKOUT STACK 69.00GBP shopify_1417820340275_12821987983411Pre-workout stack stacks automatically discounted 10% or morewhat's included?blolocohttps://redsupps.co.uk/products/pre-workout-stack-1https://cdn.shopify.com/s/files/1/2544/1734/products/LOCO-BLO-STACK_1024x_b84e6cc3-1828-4870-9fad-85b70b8fd6c9_600x600_crop_center.jpg?v=1539140221MYOBLOX new 1417820340275in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPRE-WORKOUT STACK 69.00GBP shopify_1417820340275_12821988016179Pre-workout stack stacks automatically discounted 10% or morewhat's included?blolocohttps://redsupps.co.uk/products/pre-workout-stack-1https://cdn.shopify.com/s/files/1/2544/1734/products/LOCO-BLO-STACK_1024x_b84e6cc3-1828-4870-9fad-85b70b8fd6c9_600x600_crop_center.jpg?v=1539140221MYOBLOX new 1417820340275in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPRE-WORKOUT STACK 69.00GBP shopify_1417820340275_12821988048947Pre-workout stack stacks automatically discounted 10% or morewhat's included?blolocohttps://redsupps.co.uk/products/pre-workout-stack-1https://cdn.shopify.com/s/files/1/2544/1734/products/LOCO-BLO-STACK_1024x_b84e6cc3-1828-4870-9fad-85b70b8fd6c9_600x600_crop_center.jpg?v=1539140221MYOBLOX new 1417820340275in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPRE-WORKOUT STACK 69.00GBP shopify_1417820340275_12821988081715Pre-workout stack stacks automatically discounted 10% or morewhat's included?blolocohttps://redsupps.co.uk/products/pre-workout-stack-1https://cdn.shopify.com/s/files/1/2544/1734/products/LOCO-BLO-STACK_1024x_b84e6cc3-1828-4870-9fad-85b70b8fd6c9_600x600_crop_center.jpg?v=1539140221MYOBLOX new 1417820340275in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPRE-WORKOUT STACK 69.00GBP shopify_1417820340275_12821988114483Pre-workout stack stacks automatically discounted 10% or morewhat's included?blolocohttps://redsupps.co.uk/products/pre-workout-stack-1https://cdn.shopify.com/s/files/1/2544/1734/products/LOCO-BLO-STACK_1024x_b84e6cc3-1828-4870-9fad-85b70b8fd6c9_600x600_crop_center.jpg?v=1539140221MYOBLOX new 1417820340275in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPRE-WORKOUT STACK 69.00GBP shopify_1417820340275_12821988147251Pre-workout stack stacks automatically discounted 10% or morewhat's included?blolocohttps://redsupps.co.uk/products/pre-workout-stack-1https://cdn.shopify.com/s/files/1/2544/1734/products/LOCO-BLO-STACK_1024x_b84e6cc3-1828-4870-9fad-85b70b8fd6c9_600x600_crop_center.jpg?v=1539140221MYOBLOX new 1417820340275in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPRE-WORKOUT STACK 69.00GBP shopify_1417820340275_12821988180019Pre-workout stack stacks automatically discounted 10% or morewhat's included?blolocohttps://redsupps.co.uk/products/pre-workout-stack-1https://cdn.shopify.com/s/files/1/2544/1734/products/LOCO-BLO-STACK_1024x_b84e6cc3-1828-4870-9fad-85b70b8fd6c9_600x600_crop_center.jpg?v=1539140221MYOBLOX new 1417820340275in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsPRE-WORKOUT STACK 69.00GBP shopify_435969032229_5056065798181Recomp rx benefitsall natural anabolicanti-catabolic descriptionbuilding muscle and burning fat usually requires long, arduous cycles of bulking and cutting. this never-ending merry-go-round from hell is completely exhausting and yields only modest gains at best. wouldn’t it be something if you could burn fat and build muscle at the same time, a phenomenon known as recomping.while this phenomenon is typically reserved for newbies hitting the gym for the first time, blackstone labs has developed the first supplement to let any lifter, regardless of training experience, simultaneously build muscle and burn fat.recomp rx is a revolutionary body recomposition supplement that allows you trade fat for muscle thanks to the power of ursolic acid. this potent compound is highly anabolic, as well as incredibly anti-catabolic, allowing you to build slabs of lean muscle without the needs for thousands of extra calories. gone are the days of dirty bulking and crash dieting, you now have the power to reshape your body with ease thanks to recomp rx. ingredientsursolic acid (125mg) affects molecular pathways that prevent muscle loss (catabolism) and weakness. other research has shown that ursolic acid promotes muscle hypertrophy and expression of insulin and insulin-like growth factor 1 (igf-1) signaling. and to top it off, some other research indicates, this potent compound stimulates skeletal muscle akt activity which spurs muscle growth and may reduce fat gain, a.k.a. body recomposition.banaba leaf (60mg) contains corosolic acid, a truly remarkable compound that enhance the body’s glucose-controlling properties. numerous studies have shown that banaba extracts not only improve glucose transportation, but also enhance insulin sensitivity, meaning you’ll put all those tasty carbs to building muscle, not storing body fat.. directionsas a dietary supplement, take one (1) capsule 3 times daily with food. continue for 6 weeks followed by 2 weeks off. repeat cycle.https://redsupps.co.uk/products/recomp-rx-120capshttps://cdn.shopify.com/s/files/1/2544/1734/products/recomp-yellow_600x600_crop_center.png?v=1539140229Blackstone Labs new 435969032229in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsNatural Anabolic 33.99GBP shopify_522464657459_7019780603955Rubix benefitsmetabolism ignitor †fat loss †stim-free †rubix™ is a full transparent formula of scientifically validated thermogenic ingredients including micracarn™, an exclusive micro-peptide infused carnitine.* rubix™ works on multiple facets of fat loss to aid in improved metabolism, insulin regulation and fat utilization, without utilizing caffeine or any other stimulant.* since it is stim-free, you can stack it with tetra® if desired.https://redsupps.co.uk/products/rubixhttps://cdn.shopify.com/s/files/1/2544/1734/products/Rubix_1024x_59aad16e-f938-483a-a60f-fd85400be2dd_600x600_crop_center.jpg?v=1539140250MYOBLOX new 522464657459in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsL-Carnitine 37.99GBP shopify_522464657459_7019780636723Rubix benefitsmetabolism ignitor †fat loss †stim-free †rubix™ is a full transparent formula of scientifically validated thermogenic ingredients including micracarn™, an exclusive micro-peptide infused carnitine.* rubix™ works on multiple facets of fat loss to aid in improved metabolism, insulin regulation and fat utilization, without utilizing caffeine or any other stimulant.* since it is stim-free, you can stack it with tetra® if desired.https://redsupps.co.uk/products/rubixhttps://cdn.shopify.com/s/files/1/2544/1734/products/Rubix_1024x_59aad16e-f938-483a-a60f-fd85400be2dd_600x600_crop_center.jpg?v=1539140250MYOBLOX new 522464657459in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsL-Carnitine 37.99GBP shopify_522464657459_12901443764275Rubix benefitsmetabolism ignitor †fat loss †stim-free †rubix™ is a full transparent formula of scientifically validated thermogenic ingredients including micracarn™, an exclusive micro-peptide infused carnitine.* rubix™ works on multiple facets of fat loss to aid in improved metabolism, insulin regulation and fat utilization, without utilizing caffeine or any other stimulant.* since it is stim-free, you can stack it with tetra® if desired.https://redsupps.co.uk/products/rubixhttps://cdn.shopify.com/s/files/1/2544/1734/products/Rubix_1024x_59aad16e-f938-483a-a60f-fd85400be2dd_600x600_crop_center.jpg?v=1539140250MYOBLOX new 522464657459in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsL-Carnitine 37.99GBP shopify_588184780851_7566001668147Sinfit crunch bar benefitshigh in protein with 30g per barinsanely tastymultiple layers, soft baked with a delicious coatingmuch larger than other protein bars at 83ghttps://redsupps.co.uk/products/sinfit-crunch-barhttps://cdn.shopify.com/s/files/1/2544/1734/products/SINFIT_-CHOCOLATE_1024x1024_4e8dfa4c-f00b-4404-a1a7-d229418cbe94_600x600_crop_center.jpg?v=1539140261Sinister Labs new 588184780851in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Bar 2.99GBP shopify_588184780851_7566001700915Sinfit crunch bar benefitshigh in protein with 30g per barinsanely tastymultiple layers, soft baked with a delicious coatingmuch larger than other protein bars at 83ghttps://redsupps.co.uk/products/sinfit-crunch-barhttps://cdn.shopify.com/s/files/1/2544/1734/products/SINFIT_-CHOCOLATE_1024x1024_4e8dfa4c-f00b-4404-a1a7-d229418cbe94_600x600_crop_center.jpg?v=1539140261Sinister Labs new 588184780851in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Bar 2.99GBP shopify_588184780851_7566001733683Sinfit crunch bar benefitshigh in protein with 30g per barinsanely tastymultiple layers, soft baked with a delicious coatingmuch larger than other protein bars at 83ghttps://redsupps.co.uk/products/sinfit-crunch-barhttps://cdn.shopify.com/s/files/1/2544/1734/products/SINFIT_-CHOCOLATE_1024x1024_4e8dfa4c-f00b-4404-a1a7-d229418cbe94_600x600_crop_center.jpg?v=1539140261Sinister Labs new 588184780851in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Bar 2.99GBP shopify_588184780851_12980397867059Sinfit crunch bar benefitshigh in protein with 30g per barinsanely tastymultiple layers, soft baked with a delicious coatingmuch larger than other protein bars at 83ghttps://redsupps.co.uk/products/sinfit-crunch-barhttps://cdn.shopify.com/s/files/1/2544/1734/products/SINFIT_-CHOCOLATE_1024x1024_4e8dfa4c-f00b-4404-a1a7-d229418cbe94_600x600_crop_center.jpg?v=1539140261Sinister Labs new 588184780851in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Bar 2.99GBP shopify_588175605811_7565969948723Sinfit crunch bars (12 bars) benefitshigh in protein with 30g per barinsanely tastymultiple layers, soft baked with a delicious coatingmuch larger than other protein bars at 83ghttps://redsupps.co.uk/products/sinfit-crunch-bars-12-barshttps://cdn.shopify.com/s/files/1/2544/1734/products/SINFIT__CARAMEL-CRUNCH_1024x1024_3bb38908-c296-447a-8977-33ce721f6074_600x600_crop_center.jpg?v=1539140523Sinister Labs new 588175605811in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Bar 29.99GBP shopify_588175605811_7565969981491Sinfit crunch bars (12 bars) benefitshigh in protein with 30g per barinsanely tastymultiple layers, soft baked with a delicious coatingmuch larger than other protein bars at 83ghttps://redsupps.co.uk/products/sinfit-crunch-bars-12-barshttps://cdn.shopify.com/s/files/1/2544/1734/products/SINFIT__CARAMEL-CRUNCH_1024x1024_3bb38908-c296-447a-8977-33ce721f6074_600x600_crop_center.jpg?v=1539140523Sinister Labs new 588175605811in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Bar 29.99GBP shopify_588175605811_7565970014259Sinfit crunch bars (12 bars) benefitshigh in protein with 30g per barinsanely tastymultiple layers, soft baked with a delicious coatingmuch larger than other protein bars at 83ghttps://redsupps.co.uk/products/sinfit-crunch-bars-12-barshttps://cdn.shopify.com/s/files/1/2544/1734/products/SINFIT__CARAMEL-CRUNCH_1024x1024_3bb38908-c296-447a-8977-33ce721f6074_600x600_crop_center.jpg?v=1539140523Sinister Labs new 588175605811in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Bar 29.99GBP shopify_588175605811_12980555907123Sinfit crunch bars (12 bars) benefitshigh in protein with 30g per barinsanely tastymultiple layers, soft baked with a delicious coatingmuch larger than other protein bars at 83ghttps://redsupps.co.uk/products/sinfit-crunch-bars-12-barshttps://cdn.shopify.com/s/files/1/2544/1734/products/SINFIT__CARAMEL-CRUNCH_1024x1024_3bb38908-c296-447a-8977-33ce721f6074_600x600_crop_center.jpg?v=1539140523Sinister Labs new 588175605811in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Bar 29.99GBP shopify_1449777299507_12978658476083Sinfit® protein cookie Sinfit protein cookies are soft baked to the core and perfect for the cookie lovers out there! each cookie contains 20g protein and covered in an outer icing layer, giving you the perfect high protein sweet treat! gluten-free and just 300 calories per 78g cookie. available in 4 delicious flavours: birthday cake, chocolate chip, peanut butter and snickerdoodle!https://redsupps.co.uk/products/sinfit®-protein-cookiehttps://cdn.shopify.com/s/files/1/2544/1734/products/sinfit-protein-cookie_600x600_crop_center.png?v=1539140605Sinister Labs new 1449777299507in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Cookie 2.49GBP shopify_1449777299507_12978658508851Sinfit® protein cookie Sinfit protein cookies are soft baked to the core and perfect for the cookie lovers out there! each cookie contains 20g protein and covered in an outer icing layer, giving you the perfect high protein sweet treat! gluten-free and just 300 calories per 78g cookie. available in 4 delicious flavours: birthday cake, chocolate chip, peanut butter and snickerdoodle!https://redsupps.co.uk/products/sinfit®-protein-cookiehttps://cdn.shopify.com/s/files/1/2544/1734/products/sinfit-protein-cookie_600x600_crop_center.png?v=1539140605Sinister Labs new 1449777299507in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Cookie 2.49GBP shopify_1449777299507_12978658541619Sinfit® protein cookie Sinfit protein cookies are soft baked to the core and perfect for the cookie lovers out there! each cookie contains 20g protein and covered in an outer icing layer, giving you the perfect high protein sweet treat! gluten-free and just 300 calories per 78g cookie. available in 4 delicious flavours: birthday cake, chocolate chip, peanut butter and snickerdoodle!https://redsupps.co.uk/products/sinfit®-protein-cookiehttps://cdn.shopify.com/s/files/1/2544/1734/products/sinfit-protein-cookie_600x600_crop_center.png?v=1539140605Sinister Labs new 1449777299507in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Cookie 2.49GBP shopify_1449777299507_12978658574387Sinfit® protein cookie Sinfit protein cookies are soft baked to the core and perfect for the cookie lovers out there! each cookie contains 20g protein and covered in an outer icing layer, giving you the perfect high protein sweet treat! gluten-free and just 300 calories per 78g cookie. available in 4 delicious flavours: birthday cake, chocolate chip, peanut butter and snickerdoodle!https://redsupps.co.uk/products/sinfit®-protein-cookiehttps://cdn.shopify.com/s/files/1/2544/1734/products/sinfit-protein-cookie_600x600_crop_center.png?v=1539140605Sinister Labs new 1449777299507in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Cookie 2.49GBP shopify_588245303347_7566288289843Sinfit® protein cookies (10 cookies) descriptionsinfit® peanut butter cookie 78gpeanuts… get your peanuts here!! give your taste buds a peanut butter ride of a lifetime with our peanut butter protein cookie covered with peanut butter icing and peanuts. satisfy your peanut butter sweet tooth with our soft-baked peanut butter cookie loaded with 20 grams of protein. loving peanut butter has never been so easy! sinfit® birthday cake cookie 78gblast your taste buds to the nearest birthday celebration in town with our sinfit birthday cake protein cookie. soft baked to the cookie core and covered in vanilla icing and fruit-flavored bits that will make each bite more satisfying than the last! each cookie is gluten-free and packed with 20g of protein per serving. close your eyes, make a wish, and blow out the candles and enjoy our delicious birthday cake protein cookie. (candles not included ☺) sinfit® chocolate chip cookie 78ggrandma’s homemade chocolate chip cookies may have just met their match. fall in love with chocolate all over again with our chocolate chip protein cookie covered with chocolate icing and chocolate chips. our chocolate chip protein cookie was specifically designed and specially made for all the chocolate lovers and enthusiasts around the world. each chocolate chip cookie is gluten-free and packed with 20 grams of protein, meeting your daily protein has never been so delicious. crush your chocolate cravings one chocolate chip cookie at a time! sinfit® snickerdoodle cookie 78gthe perfect blend of cinnamon and sweet with our sinister twist of chocolate chips topped with graham pieces! if you are going to have a cheat snack you cannot go wrong with this exquisite treat. it’s more than a dessert, it’s an experience!https://redsupps.co.uk/products/sinfit®-protein-cookies-10-cookieshttps://cdn.shopify.com/s/files/1/2544/1734/products/SINFIT_SNICKERDOODLE_COOKIE_1024x1024_1024x1024_cf93cf07-0299-4cf1-9d2d-a0f01456e06f_600x600_crop_center.jpg?v=1539140610Sinister Labs new 588245303347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Cookie 19.99GBP shopify_588245303347_7566301200435Sinfit® protein cookies (10 cookies) descriptionsinfit® peanut butter cookie 78gpeanuts… get your peanuts here!! give your taste buds a peanut butter ride of a lifetime with our peanut butter protein cookie covered with peanut butter icing and peanuts. satisfy your peanut butter sweet tooth with our soft-baked peanut butter cookie loaded with 20 grams of protein. loving peanut butter has never been so easy! sinfit® birthday cake cookie 78gblast your taste buds to the nearest birthday celebration in town with our sinfit birthday cake protein cookie. soft baked to the cookie core and covered in vanilla icing and fruit-flavored bits that will make each bite more satisfying than the last! each cookie is gluten-free and packed with 20g of protein per serving. close your eyes, make a wish, and blow out the candles and enjoy our delicious birthday cake protein cookie. (candles not included ☺) sinfit® chocolate chip cookie 78ggrandma’s homemade chocolate chip cookies may have just met their match. fall in love with chocolate all over again with our chocolate chip protein cookie covered with chocolate icing and chocolate chips. our chocolate chip protein cookie was specifically designed and specially made for all the chocolate lovers and enthusiasts around the world. each chocolate chip cookie is gluten-free and packed with 20 grams of protein, meeting your daily protein has never been so delicious. crush your chocolate cravings one chocolate chip cookie at a time! sinfit® snickerdoodle cookie 78gthe perfect blend of cinnamon and sweet with our sinister twist of chocolate chips topped with graham pieces! if you are going to have a cheat snack you cannot go wrong with this exquisite treat. it’s more than a dessert, it’s an experience!https://redsupps.co.uk/products/sinfit®-protein-cookies-10-cookieshttps://cdn.shopify.com/s/files/1/2544/1734/products/SINFIT_SNICKERDOODLE_COOKIE_1024x1024_1024x1024_cf93cf07-0299-4cf1-9d2d-a0f01456e06f_600x600_crop_center.jpg?v=1539140610Sinister Labs new 588245303347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Cookie 19.99GBP shopify_588245303347_7566301233203Sinfit® protein cookies (10 cookies) descriptionsinfit® peanut butter cookie 78gpeanuts… get your peanuts here!! give your taste buds a peanut butter ride of a lifetime with our peanut butter protein cookie covered with peanut butter icing and peanuts. satisfy your peanut butter sweet tooth with our soft-baked peanut butter cookie loaded with 20 grams of protein. loving peanut butter has never been so easy! sinfit® birthday cake cookie 78gblast your taste buds to the nearest birthday celebration in town with our sinfit birthday cake protein cookie. soft baked to the cookie core and covered in vanilla icing and fruit-flavored bits that will make each bite more satisfying than the last! each cookie is gluten-free and packed with 20g of protein per serving. close your eyes, make a wish, and blow out the candles and enjoy our delicious birthday cake protein cookie. (candles not included ☺) sinfit® chocolate chip cookie 78ggrandma’s homemade chocolate chip cookies may have just met their match. fall in love with chocolate all over again with our chocolate chip protein cookie covered with chocolate icing and chocolate chips. our chocolate chip protein cookie was specifically designed and specially made for all the chocolate lovers and enthusiasts around the world. each chocolate chip cookie is gluten-free and packed with 20 grams of protein, meeting your daily protein has never been so delicious. crush your chocolate cravings one chocolate chip cookie at a time! sinfit® snickerdoodle cookie 78gthe perfect blend of cinnamon and sweet with our sinister twist of chocolate chips topped with graham pieces! if you are going to have a cheat snack you cannot go wrong with this exquisite treat. it’s more than a dessert, it’s an experience!https://redsupps.co.uk/products/sinfit®-protein-cookies-10-cookieshttps://cdn.shopify.com/s/files/1/2544/1734/products/SINFIT_SNICKERDOODLE_COOKIE_1024x1024_1024x1024_cf93cf07-0299-4cf1-9d2d-a0f01456e06f_600x600_crop_center.jpg?v=1539140610Sinister Labs new 588245303347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Cookie 19.99GBP shopify_588245303347_12978560008243Sinfit® protein cookies (10 cookies) descriptionsinfit® peanut butter cookie 78gpeanuts… get your peanuts here!! give your taste buds a peanut butter ride of a lifetime with our peanut butter protein cookie covered with peanut butter icing and peanuts. satisfy your peanut butter sweet tooth with our soft-baked peanut butter cookie loaded with 20 grams of protein. loving peanut butter has never been so easy! sinfit® birthday cake cookie 78gblast your taste buds to the nearest birthday celebration in town with our sinfit birthday cake protein cookie. soft baked to the cookie core and covered in vanilla icing and fruit-flavored bits that will make each bite more satisfying than the last! each cookie is gluten-free and packed with 20g of protein per serving. close your eyes, make a wish, and blow out the candles and enjoy our delicious birthday cake protein cookie. (candles not included ☺) sinfit® chocolate chip cookie 78ggrandma’s homemade chocolate chip cookies may have just met their match. fall in love with chocolate all over again with our chocolate chip protein cookie covered with chocolate icing and chocolate chips. our chocolate chip protein cookie was specifically designed and specially made for all the chocolate lovers and enthusiasts around the world. each chocolate chip cookie is gluten-free and packed with 20 grams of protein, meeting your daily protein has never been so delicious. crush your chocolate cravings one chocolate chip cookie at a time! sinfit® snickerdoodle cookie 78gthe perfect blend of cinnamon and sweet with our sinister twist of chocolate chips topped with graham pieces! if you are going to have a cheat snack you cannot go wrong with this exquisite treat. it’s more than a dessert, it’s an experience!https://redsupps.co.uk/products/sinfit®-protein-cookies-10-cookieshttps://cdn.shopify.com/s/files/1/2544/1734/products/SINFIT_SNICKERDOODLE_COOKIE_1024x1024_1024x1024_cf93cf07-0299-4cf1-9d2d-a0f01456e06f_600x600_crop_center.jpg?v=1539140610Sinister Labs new 588245303347in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsProtein Cookie 19.99GBP shopify_619300913203_7775573377075Skywalk benefitssmooth energy / no crash †increase euphoric mood †boost mental drive †support focus & memory †skywalk™ is the most ultra-premium focus powder on the market containing nine highly novel compounds each dosed in their most effective amounts to serve as the lifeblood of mental drive for the individual constantly on the grind. this formula works on many different aspects towards brain optimization, such as the synthesis of powerful neurotransmitters, neuro-protectant properties, which in turn fight against mental degeneration, and increase the efficiency of communications between the brain cells.† augment memory recall, laser focus, mental energy, stress reduction and levitate to a higher mind with the only nootropic super powder that is actually dosed effectively for results you can truly feel.† the formula of skywalk™ is leaps ahead of the other nootropic products on the market because skywalk™ works smarter.https://redsupps.co.uk/products/skywalkhttps://cdn.shopify.com/s/files/1/2544/1734/products/IMG_0474_600x600_crop_center.jpg?v=1539195371MYOBLOX new 619300913203in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsNootropic Formula 37.99GBP shopify_619300913203_7775573409843Skywalk benefitssmooth energy / no crash †increase euphoric mood †boost mental drive †support focus & memory †skywalk™ is the most ultra-premium focus powder on the market containing nine highly novel compounds each dosed in their most effective amounts to serve as the lifeblood of mental drive for the individual constantly on the grind. this formula works on many different aspects towards brain optimization, such as the synthesis of powerful neurotransmitters, neuro-protectant properties, which in turn fight against mental degeneration, and increase the efficiency of communications between the brain cells.† augment memory recall, laser focus, mental energy, stress reduction and levitate to a higher mind with the only nootropic super powder that is actually dosed effectively for results you can truly feel.† the formula of skywalk™ is leaps ahead of the other nootropic products on the market because skywalk™ works smarter.https://redsupps.co.uk/products/skywalkhttps://cdn.shopify.com/s/files/1/2544/1734/products/IMG_0474_600x600_crop_center.jpg?v=1539195371MYOBLOX new 619300913203in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsNootropic Formula 37.99GBP shopify_619300913203_13226992205875Skywalk benefitssmooth energy / no crash †increase euphoric mood †boost mental drive †support focus & memory †skywalk™ is the most ultra-premium focus powder on the market containing nine highly novel compounds each dosed in their most effective amounts to serve as the lifeblood of mental drive for the individual constantly on the grind. this formula works on many different aspects towards brain optimization, such as the synthesis of powerful neurotransmitters, neuro-protectant properties, which in turn fight against mental degeneration, and increase the efficiency of communications between the brain cells.† augment memory recall, laser focus, mental energy, stress reduction and levitate to a higher mind with the only nootropic super powder that is actually dosed effectively for results you can truly feel.† the formula of skywalk™ is leaps ahead of the other nootropic products on the market because skywalk™ works smarter.https://redsupps.co.uk/products/skywalkhttps://cdn.shopify.com/s/files/1/2544/1734/products/IMG_0474_600x600_crop_center.jpg?v=1539195371MYOBLOX new 619300913203in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsNootropic Formula 37.99GBP shopify_691184500787_8412957245491Support stack stacks automatically discounted 10% or morewhat's included?glycologrecomp rxhttps://redsupps.co.uk/products/support-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/support-stack_600x600_crop_center.png?v=1539140743Blackstone Labs new 691184500787in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsSupport Stack 70.99GBP shopify_619360944179_7775799803955Tetra benefitssuperior thermogenesis †smooth energy †cravings control †supports fat loss †tetra® is an ultra-premium thermogenic formula designed to ignite metabolism, energy, focus and works on multiple fat-loss pathways †. despite the profound increase in metabolism, you'll feel great while using it due to its euphoric matrix. make tetra® your next fat-loss hack and experience its euphoric fire firsthand.https://redsupps.co.uk/products/tetra-iiihttps://cdn.shopify.com/s/files/1/2544/1734/products/Tetra_1024x_30ddad30-dd8e-4ee5-b793-232f9a92ed7c_600x600_crop_center.jpg?v=1539140746MYOBLOX new 619360944179in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsFat Burner 39.00GBP shopify_621501448243_7787153817651The best night of your lives for couples, intimacy is key. knowing your partner and sharing exciting sexual experiences is paramount to any healthy relationship. entice recognizes that there are rising levels of interest in upping the bar in the bedroom for both men and women, which is why we have developed products for both sexes.with entice him, increase your levels of arousal, size, and performance for some really intense times. with entice her, increase your sensitivity, and arousal. take both of them together for the most memorable night of your lives. take your intimacy to areas you never thought possible with this convenient bundle of both products. take a chance. go wild. entice each other in ways you never dreamt of.contains one bottle each of entice her and entice him.https://redsupps.co.uk/products/the-best-night-of-your-liveshttps://cdn.shopify.com/s/files/1/2544/1734/products/image_8c256507-bace-44c1-8118-05b0ea7deecf_600x600_crop_center.png?v=1539140753Entice new 621501448243in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsSexual Performance Formula 59.99GBP shopify_369638572069_4714173071397Thermal shirt Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym.show everyone that when it's time to get down, you mean business with your blackstone labs swag. https://redsupps.co.uk/products/blackstone-labs-thermal-shirthttps://cdn.shopify.com/s/files/1/2544/1734/products/blackstone-labs-thermal-shirt-blackstone-labs-thermal-shirt-22105651217_600x600_crop_center.jpg?v=1539140755Blackstone Labs new 369638572069in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsThermal Shirt 15.99GBP shopify_369638572069_8438662398003Thermal shirt Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym.show everyone that when it's time to get down, you mean business with your blackstone labs swag. https://redsupps.co.uk/products/blackstone-labs-thermal-shirthttps://cdn.shopify.com/s/files/1/2544/1734/products/blackstone-labs-thermal-shirt-blackstone-labs-thermal-shirt-22105651217_600x600_crop_center.jpg?v=1539140755Blackstone Labs new 369638572069in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsThermal Shirt 15.99GBP shopify_369638572069_4714173104165Thermal shirt Whenever people ask you where your insane gains come from, save yourself the spiel and simply just point. all you have to say now is "blackstone labs, baby." no more stop and chat, just steady grinding at the gym.show everyone that when it's time to get down, you mean business with your blackstone labs swag. https://redsupps.co.uk/products/blackstone-labs-thermal-shirthttps://cdn.shopify.com/s/files/1/2544/1734/products/blackstone-labs-thermal-shirt-blackstone-labs-thermal-shirt-22105651217_600x600_crop_center.jpg?v=1539140755Blackstone Labs new 369638572069in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsThermal Shirt 15.99GBP shopify_677067456563_8257697873971Tighten the f' up stack stacks automatically discounted 10% or morewhat's included?chosen 1eradicategear supportparaburntrojan horse https://redsupps.co.uk/products/tighten-the-f-up-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/tighten-the-fuck-up_1024x_846c9eca-3dc6-4500-a1e3-c4471471444b_600x600_crop_center.png?v=1539140764Blackstone Labs new 677067456563out of stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 152.00GBP shopify_677067456563_8257697939507Tighten the f' up stack stacks automatically discounted 10% or morewhat's included?chosen 1eradicategear supportparaburntrojan horse https://redsupps.co.uk/products/tighten-the-f-up-stackhttps://cdn.shopify.com/s/files/1/2544/1734/products/tighten-the-fuck-up_1024x_846c9eca-3dc6-4500-a1e3-c4471471444b_600x600_crop_center.png?v=1539140764Blackstone Labs new 677067456563out of stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsStack 152.00GBP shopify_369641586725_4714184015909Trojan horse trojan horsestimulant freeburns fat to the ground descriptionconventional fat burners are all the same -- cobble together as many stimulants as you can under a proprietary blend and cram them all in a tiny capsule. while this approach makes for higher profit margins, it does nothing for your fat loss desires and in all likelihood makes you feel on edge or stimmed out. therein lies the problem -- true fat burning isn’t about taking a bunch of stims, it’s about enhancing your body’s natural fat burning mechanisms to search out and destroy unsightly body fat. now, you can get all the fat burning benefits of a traditional fat burner without the truckload of unwanted stims in trojan horse.trojan horse is your secret weapon to invade stubborn fat cells and blast them into oblivion. using a collection of proven stimulant-free fat burning ingredients, trojan horse helps you lose weight fast, but without the anxiety, jitters, or crash of traditional fat burners. with trojan horse, you can take the war to fat’s front door and knock it down for good. instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water upon waking up. an additional scoop can be taken in the evening before bed. do not exceed three (3) scoops daily.https://redsupps.co.uk/products/blackstone-labs-trojan-horse-60-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/trojanhorse-blackcurrant_600x600_crop_center.png?v=1539140767Blackstone Labs new 369641586725in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsNon Stimulant Fat Burner 29.99GBP shopify_369641586725_4714184048677Trojan horse trojan horsestimulant freeburns fat to the ground descriptionconventional fat burners are all the same -- cobble together as many stimulants as you can under a proprietary blend and cram them all in a tiny capsule. while this approach makes for higher profit margins, it does nothing for your fat loss desires and in all likelihood makes you feel on edge or stimmed out. therein lies the problem -- true fat burning isn’t about taking a bunch of stims, it’s about enhancing your body’s natural fat burning mechanisms to search out and destroy unsightly body fat. now, you can get all the fat burning benefits of a traditional fat burner without the truckload of unwanted stims in trojan horse.trojan horse is your secret weapon to invade stubborn fat cells and blast them into oblivion. using a collection of proven stimulant-free fat burning ingredients, trojan horse helps you lose weight fast, but without the anxiety, jitters, or crash of traditional fat burners. with trojan horse, you can take the war to fat’s front door and knock it down for good. instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water upon waking up. an additional scoop can be taken in the evening before bed. do not exceed three (3) scoops daily.https://redsupps.co.uk/products/blackstone-labs-trojan-horse-60-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/trojanhorse-blackcurrant_600x600_crop_center.png?v=1539140767Blackstone Labs new 369641586725in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsNon Stimulant Fat Burner 29.99GBP shopify_369641586725_12624140075059Trojan horse trojan horsestimulant freeburns fat to the ground descriptionconventional fat burners are all the same -- cobble together as many stimulants as you can under a proprietary blend and cram them all in a tiny capsule. while this approach makes for higher profit margins, it does nothing for your fat loss desires and in all likelihood makes you feel on edge or stimmed out. therein lies the problem -- true fat burning isn’t about taking a bunch of stims, it’s about enhancing your body’s natural fat burning mechanisms to search out and destroy unsightly body fat. now, you can get all the fat burning benefits of a traditional fat burner without the truckload of unwanted stims in trojan horse.trojan horse is your secret weapon to invade stubborn fat cells and blast them into oblivion. using a collection of proven stimulant-free fat burning ingredients, trojan horse helps you lose weight fast, but without the anxiety, jitters, or crash of traditional fat burners. with trojan horse, you can take the war to fat’s front door and knock it down for good. instructionsas a dietary supplement, mix one (1) scoop in 8-10 oz. of water upon waking up. an additional scoop can be taken in the evening before bed. do not exceed three (3) scoops daily.https://redsupps.co.uk/products/blackstone-labs-trojan-horse-60-servingshttps://cdn.shopify.com/s/files/1/2544/1734/products/trojanhorse-blackcurrant_600x600_crop_center.png?v=1539140767Blackstone Labs new 369641586725in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsNon Stimulant Fat Burner 29.99GBP shopify_1458929762355_13091036692531Ubiquinol 200 mg extra strength descriptioncardiovascular healthactive form of coq10highly bioavailablea dietary supplementmade with quality kaneka ubiquinolgeneral healthfamily owned since 1968gmp quality assuredubiquinol is the reduced and active free radical quencher form of coenzyme q10 (coq10). coq10 is found in all cells of the body, and is essential to mitochondrial energy production and functions as a powerful, fat soluble, free radical scavenger. these properties make ubiquinol an ideal supplement for the support of energy production and free radical protection in the heart, vascular structures, brain and neurons. ubiquinol has been shown to be highly bioavailable and the addition of mct oil (medium chain triglycerides) to this product naturally improves its solubility and enhances intestinal absorption, thereby creating a product with superior biological value. suggested usetake 1 softgel daily with a fat-containing meal. other ingredientsmct oil (medium chain triglycerides), softgel capsule (bovine gelatin, glycerin, water, carob) and beeswax.mct oil from coconut/palm kernel oil.not manufactured with wheat, gluten, soy, milk, egg, fish or shellfish ingredients. produced in a gmp facility that processes other ingredients. produced in a gmp facility that processes other ingredients containing these allergens.now coq10 products contain only the natural, all-trans form of coq10 produced by fermentation.now extra strength ubiquinol has twice the ubiquinol (200 mg per softgel) as in our regular strength product (100 mg per softgel).natural color variation may occur in this product. suggested usetake 1 capsule daily with a meal. other ingredientsrice flour, cellulose (capsule) and magnesium stearate (vegetable source).not manufactured with wheat, gluten, soy, corn, milk, egg, fish, shellfish or tree nut ingredients. produced in a gmp facility that processes other ingredients containing these allergens.https://redsupps.co.uk/products/ubiquinol-200-mg-extra-strengthhttps://cdn.shopify.com/s/files/1/2544/1734/products/ubiquinol_600x600_crop_center.jpg?v=1539140858NOW FOODS new 1458929762355in stockHealth & Beauty > Health Care > Fitness & Nutrition > Vitamins & SupplementsActive Form of CoQ10 49.99GBP